Protein Info for BWI76_RS20390 in Klebsiella michiganensis M5al

Annotation: erythronate-4-phosphate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 378 PF00389: 2-Hacid_dh" amino acids 4 to 279 (276 residues), 69 bits, see alignment E=5e-23 PF02826: 2-Hacid_dh_C" amino acids 110 to 256 (147 residues), 110.3 bits, see alignment E=1.1e-35 PF11890: DUF3410" amino acids 289 to 369 (81 residues), 99 bits, see alignment E=1.7e-32

Best Hits

Swiss-Prot: 93% identical to PDXB_KLEP3: Erythronate-4-phosphate dehydrogenase (pdxB) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: K03473, erythronate-4-phosphate dehydrogenase [EC: 1.1.1.290] (inferred from 93% identity to kpe:KPK_1434)

MetaCyc: 85% identical to erythronate-4-phosphate dehydrogenase (Escherichia coli K-12 substr. MG1655)
4-phosphoerythronate dehydrogenase. [EC: 1.1.1.290]

Predicted SEED Role

"Erythronate-4-phosphate dehydrogenase (EC 1.1.1.290)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 1.1.1.290)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.290

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B783 at UniProt or InterPro

Protein Sequence (378 amino acids)

>BWI76_RS20390 erythronate-4-phosphate dehydrogenase (Klebsiella michiganensis M5al)
MKILVDENMPYARELFSRLGEVKAVAGRPVPVDALNDADALMVRSVTKVNEALLSGKAIK
FVGTATAGTDHVDQAWLQQAGIGFSAAPGCNAIAVVEYVFSALLILAERDGFALSDRTVG
IVGVGNVGGRLQKRLEALGIKTLLCDPPRADRGDEGDFHTLDELVQEADILTFHTPLYKE
GQYKTLHLADEALIRRLKPGTILINACRGPVVDNAALLQRLQANQSLSVVLDVWEPEPDL
NTELLKRVDIGTPHIAGYTLEGKARGTTQVFEAYSAFIGHPQQVALDTLLPAPEFGRITL
HGPLDQATLKRLAHLVYDVRRDDAPLRKVAGVAGEFDKLRKNYQERREWSSLYVQCSDAQ
AATLLRQLGFNAVHHPVR