Protein Info for BWI76_RS20360 in Klebsiella michiganensis M5al

Annotation: cell division protein DedD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 229 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF05036: SPOR" amino acids 150 to 223 (74 residues), 45.4 bits, see alignment E=4.3e-16

Best Hits

Swiss-Prot: 77% identical to DEDD_ECOLI: Cell division protein DedD (dedD) from Escherichia coli (strain K12)

KEGG orthology group: K03749, DedD protein (inferred from 87% identity to kpe:KPK_1440)

Predicted SEED Role

"DedD protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B6Z3 at UniProt or InterPro

Protein Sequence (229 amino acids)

>BWI76_RS20360 cell division protein DedD (Klebsiella michiganensis M5al)
MASKFQNRLVGTIVLVALGVIILPGLLDGQKKHYQDEFAAIPLVPKPGDRDEPDMLPAAT
QALPSQPPEGAAEEVRAGDAAAPSLDPSRIPVNNNSFDVVQEPVVTPKPQPKPQPKPQPK
PVEKPQTQQVTAQTPPPKPQQQAEIPAPTGKAYVVQLGALKNADKVNEIVGKLRASGFKV
YTSPSTPVQGKITRILVGPDTSKDKLKGQLGELKQISGLSGVVMGYSPN