Protein Info for BWI76_RS20350 in Klebsiella michiganensis M5al

Annotation: amidophosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 505 TIGR01134: amidophosphoribosyltransferase" amino acids 2 to 466 (465 residues), 542.6 bits, see alignment E=4.9e-167 PF13230: GATase_4" amino acids 63 to 166 (104 residues), 23.7 bits, see alignment E=4.4e-09 PF13522: GATase_6" amino acids 64 to 196 (133 residues), 56.1 bits, see alignment E=7.9e-19 PF13537: GATase_7" amino acids 81 to 214 (134 residues), 47.4 bits, see alignment E=4e-16 PF00156: Pribosyltran" amino acids 287 to 395 (109 residues), 31.6 bits, see alignment E=2e-11

Best Hits

Swiss-Prot: 96% identical to PUR1_ECOLI: Amidophosphoribosyltransferase (purF) from Escherichia coli (strain K12)

KEGG orthology group: K00764, amidophosphoribosyltransferase [EC: 2.4.2.14] (inferred from 96% identity to ent:Ent638_2861)

MetaCyc: 96% identical to amidophosphoribosyltransferase (Escherichia coli K-12 substr. MG1655)
Amidophosphoribosyltransferase. [EC: 2.4.2.14]

Predicted SEED Role

"Amidophosphoribosyltransferase (EC 2.4.2.14)" in subsystem De Novo Purine Biosynthesis (EC 2.4.2.14)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B757 at UniProt or InterPro

Protein Sequence (505 amino acids)

>BWI76_RS20350 amidophosphoribosyltransferase (Klebsiella michiganensis M5al)
MCGIVGIAGVMPVNQSIYDALTVLQHRGQDAAGIITIDANNCFRLRKANGLVSDVFEARH
MQRMQGNMGIGHVRYPTAGSSSASEAQPFYVNSPYGITLAHNGNLTNAHELRKKLFEEKR
RHINTTSDSEILLNIFASELDNYRHYPLEADNIFAAIAATNRQIRGAYACVAMIIGHGMV
AFRDPNGIRPLVLGKRDIGDGRTEYMVASESVALDTLGFEFLRDVAPGEAVYITEKGQLF
TRQCAENPVSNPCLFEYVYFARPDSFIDKISVYSARVNMGTKLGEKIAREWEDLDIDVVI
PIPETSCDIALEIARILDKPYRQGFVKNRYVGRTFIMPGQQLRRKSVRRKLNANRAEFRD
KNVLLVDDSIVRGTTSEQIIEMAREAGAKKVYLASAAPEIRFPNVYGIDMPTANELIAHG
REVDEIRQIIGADGLIFQDLDDLIDAVRAENPDIQQFECSVFNGIYVTKDVDQQYLDYLD
SLRNDDAKAVQLQNEVENLEMHNEG