Protein Info for BWI76_RS20290 in Klebsiella michiganensis M5al

Annotation: thiol:disulfide oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 209 PF02798: GST_N" amino acids 4 to 81 (78 residues), 42.1 bits, see alignment E=2.8e-14 PF13417: GST_N_3" amino acids 4 to 83 (80 residues), 35.7 bits, see alignment E=2.6e-12 PF13409: GST_N_2" amino acids 10 to 81 (72 residues), 43.7 bits, see alignment E=1e-14 PF13410: GST_C_2" amino acids 128 to 192 (65 residues), 32.5 bits, see alignment E=2.2e-11 PF00043: GST_C" amino acids 134 to 197 (64 residues), 38.5 bits, see alignment E=3.5e-13 PF14497: GST_C_3" amino acids 135 to 198 (64 residues), 25.2 bits, see alignment E=4.9e-09

Best Hits

Swiss-Prot: 81% identical to YFCG_ECOLI: Disulfide-bond oxidoreductase YfcG (yfcG) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 89% identity to eae:EAE_24495)

MetaCyc: 81% identical to disulfide bond oxidoreductase YfcG (Escherichia coli K-12 substr. MG1655)
RXN0-6256

Predicted SEED Role

"Probable glutathione S-transferase (EC 2.5.1.18), YfcG homolog" in subsystem Glutathione: Non-redox reactions (EC 2.5.1.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.18

Use Curated BLAST to search for 2.5.1.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B759 at UniProt or InterPro

Protein Sequence (209 amino acids)

>BWI76_RS20290 thiol:disulfide oxidoreductase (Klebsiella michiganensis M5al)
MIDLYYAPTPNGHKITLFLEEAQLPYRLIRVDISKGEQFQPSFLAISPNNKIPAIVDDAP
ADGGAPLSLFESGEILLYLAEKTGKLLSGELRERHVTLQWLFWQVGGLGPMLGQNHHFNH
FAPQAVPYAIERYQVETQRLYGVLNRRLGESPWLGGNHYSIADIACWPWVNAHQRQRIDL
ASFPAVHNWFERIRQRPATVEALLKTEAH