Protein Info for BWI76_RS20200 in Klebsiella michiganensis M5al

Annotation: transcriptional regulator LrhA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 transmembrane" amino acids 20 to 35 (16 residues), see Phobius details PF00126: HTH_1" amino acids 13 to 71 (59 residues), 63.4 bits, see alignment E=1.5e-21 PF03466: LysR_substrate" amino acids 96 to 285 (190 residues), 88.9 bits, see alignment E=3.1e-29

Best Hits

Swiss-Prot: 64% identical to LRHA_ECO57: Probable HTH-type transcriptional regulator LrhA (lrhA) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 81% identity to eae:EAE_24435)

Predicted SEED Role

"LysR family transcriptional regulator lrhA" in subsystem DNA-binding regulatory proteins, strays

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B731 at UniProt or InterPro

Protein Sequence (308 amino acids)

>BWI76_RS20200 transcriptional regulator LrhA (Klebsiella michiganensis M5al)
MINENRSILNLDLDLLRTFVAVADLNTFAAAAVAVCRTQSAVSQQMQRLEQLVGKELFAR
QGRNKLLTEQGIQLLGYARKILRFNDEACMSLMFGSLQGTLTVGASDETADTILPCLLNR
IGSFYPRLTLEIKVLNHIDIVDRLKKGAIDLALTTRPTKGFDMLTLRASPTLWYCAADYV
LPQGESVPLVLLDAPDPFREEIVAVLNAARVPWHLSHAATSMAGVKAAVKAGLGVTAQPV
EMMSPEFRVPGRCDGLPVLPDTHYMLNCDSQQASELTQAIFQSLSAEYQPWSTQRVYTPE
GGDNSLIS