Protein Info for BWI76_RS20185 in Klebsiella michiganensis M5al

Annotation: NADH-quinone oxidoreductase subunit B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 TIGR01957: NADH-quinone oxidoreductase, B subunit" amino acids 46 to 182 (137 residues), 230.2 bits, see alignment E=4e-73 PF01058: Oxidored_q6" amino acids 67 to 175 (109 residues), 94 bits, see alignment E=3e-31

Best Hits

Swiss-Prot: 100% identical to NUOB_KLEP3: NADH-quinone oxidoreductase subunit B (nuoB) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: K00331, NADH dehydrogenase I subunit B [EC: 1.6.5.3] (inferred from 99% identity to ent:Ent638_2831)

MetaCyc: 97% identical to NADH:quinone oxidoreductase subunit B (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain B (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B737 at UniProt or InterPro

Protein Sequence (224 amino acids)

>BWI76_RS20185 NADH-quinone oxidoreductase subunit B (Klebsiella michiganensis M5al)
MDYTLTRIDPNGENDRYPLQKQEIVTDPLEQEVNKSVYMGKLEHALHDMVNWGRKNSIWP
YNFGLSCCYVEMVTSFTAVHDVARFGAEVLRASPRQADLMVVAGTCFTKMAPVIQRLYDQ
MLEPKWVISMGACANSGGMYDIYSVVQGVDKFIPVDVYIPGCPPRPEAYMQALMLLQESI
GKERRPLSWVVGDQGVYRANMQSERERKRGERIAVTNLRTPDEI