Protein Info for BWI76_RS20155 in Klebsiella michiganensis M5al

Annotation: NADH-quinone oxidoreductase subunit I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01971: NADH-quinone oxidoreductase, chain I
  • amino acids 16 to 137 (122 residues), 168.6 bits, E=1.9e-54
• PF13237: Fer4_10
  • amino acids 57 to 110 (54 residues), 31.3 bits, E=9.2e-11
• PF00037: Fer4
  • amino acids 57 to 76 (20 residues), 22.3 bits, see alignment (E = 5e-08)
  • amino acids 93 to 115 (23 residues), 35.1 bits, see alignment (E = 4.3e-12)
• PF12800: Fer4_4
  • amino acids 58 to 73 (16 residues), 16.3 bits, see alignment (E = 5.5e-06)
  • amino acids 97 to 111 (15 residues), 15.2 bits, see alignment (E = 1.3e-05)
• PF12838: Fer4_7
  • amino acids 59 to 113 (55 residues), 45.3 bits, E=5.4e-15
• PF13187: Fer4_9
  • amino acids 59 to 114 (56 residues), 28.8 bits, E=5.6e-10

Best Hits

Swiss-Prot: 99% identical to NUOI_SALPA: NADH-quinone oxidoreductase subunit I (nuoI) from Salmonella paratyphi A (strain ATCC 9150 / SARB42)

KEGG orthology group: K00338, NADH dehydrogenase I subunit I [EC: 1.6.5.3] (inferred from 98% identity to eco:b2281)

MetaCyc: 98% identical to NADH:quinone oxidoreductase subunit I (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain I (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

• aerobic respiration III (alternative oxidase pathway) (3/3 steps found)
• NADH to cytochrome bd oxidase electron transfer I (2/2 steps found)
• NAD(P)/NADPH interconversion (4/6 steps found)
• NADH to cytochrome bo oxidase electron transfer I (1/2 steps found)
• aerobic respiration I (cytochrome c) (2/4 steps found)
• Fe(II) oxidation (1/6 steps found)

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

See A0A285B6V6 at UniProt or InterPro

Protein Sequence (180 amino acids)

>BWI76_RS20155 NADH-quinone oxidoreductase subunit I (Klebsiella michiganensis M5al)
MTLKELLVGFGTQVRSICMIGMHAFAKRETRMYPEEPVYLPPRYRGRIVLTRDPDGEERC
VACNLCAVACPVGCISLQKAETKDGRWYPEFFRINFSRCIFCGLCEEACPTTAIQLTPDF
ELGEYKRQDLVYEKEDLLISGPGKYPEYNFYRMAGMAIDGKDKGEAENEAKPIDVKSLLP