Protein Info for BWI76_RS19905 in Klebsiella michiganensis M5al

Annotation: OmpK36 porin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF00267: Porin_1" amino acids 27 to 372 (346 residues), 476.2 bits, see alignment E=3.6e-147

Best Hits

Swiss-Prot: 92% identical to OMPC_KLEPN: Outer membrane porin C (ompC) from Klebsiella pneumoniae

KEGG orthology group: K09475, outer membrane pore protein C (inferred from 93% identity to kpn:KPN_02636)

MetaCyc: 79% identical to outer membrane porin C (Escherichia coli K-12 substr. MG1655)
RXN0-2481; RXN0-7199; RXN0-7200; RXN0-7201; RXN0-7202; RXN0-7203; RXN0-7204; RXN0-7206; RXN0-7207; RXN0-7208; RXN0-7209; RXN0-7210; RXN0-7211; RXN0-7241; RXN0-7242; RXN0-7243; RXN0-7244; RXN0-7245; RXN0-7246; RXN0-7247; TRANS-RXN0-490; TRANS-RXN0-598; TRANS-RXN0-601; TRANS-RXN0-603; TRANS-RXN0-604; TRANS-RXN0-606; TRANS-RXN0-607; TRANS-RXN0-608; TRANS-RXN0-609; TRANS-RXN0-611; TRANS-RXN0-612; TRANS-RXN0-614; TRANS-RXN0-615

Predicted SEED Role

"Outer membrane protein C precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (372 amino acids)

>BWI76_RS19905 OmpK36 porin (Klebsiella michiganensis M5al)
MKVKVLSLLVPALLVAGAANAAEVYNKDGNKLDLYGKIDGLHYFSDDKGQDGDQTYMRLG
IKGETQINDQLTGYGQWEYNVQANNTESSSDQAWTRLAFAGLKFGDAGSFDYGRNYGVVY
DVTSWTDVLPEFGGDTYGSDNFLQSRANGVATYRNSDFFGLVDGLNFALQYQGKNGSVSG
EGTSPTNNGRGALKQNGDGYGTSLTYDIYDGISAGFAYANSKRNGDQNSQLALGQGDNAE
TYTGGLKYDANNIYLASQYTQTYNATRVGSLGFANKAQNFEVVAQYQFDFGLRPSVAYLQ
SKGKDLYINGTNRSYGDQDILKYVDVGATYYFNKNMSTYVDYKINLLDENNFTRAAGIST
DDIVALGLVYQF