Protein Info for BWI76_RS19770 in Klebsiella michiganensis M5al

Annotation: bifunctional murein DD-endopeptidase/murein LD-carboxypeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 87% identical to MEPS_ECO57: Murein DD-endopeptidase MepS/Murein LD-carboxypeptidase (mepS) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 96% identity to eae:EAE_24070)

MetaCyc: 87% identical to peptidoglycan endopeptidase/peptidoglycan L,D-carboxypeptidase (Escherichia coli K-12 substr. MG1655)
Muramoyltetrapeptide carboxypeptidase. [EC: 3.4.17.13]; 3.4.-.- [EC: 3.4.17.13]; 3.4.-.- [EC: 3.4.17.13]

Predicted SEED Role

"Lipoprotein spr precursor"

MetaCyc Pathways

peptidoglycan recycling I (14/14 steps found)
muropeptide degradation (4/4 steps found)
peptidoglycan recycling II (7/10 steps found)
peptidoglycan maturation (meso-diaminopimelate containing) (5/12 steps found)

Isozymes

Compare fitness of predicted isozymes for: 3.4.17.13

Use Curated BLAST to search for 3.4.17.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B6Z4 at UniProt or InterPro

Protein Sequence (189 amino acids)

>BWI76_RS19770 bifunctional murein DD-endopeptidase/murein LD-carboxypeptidase (Klebsiella michiganensis M5al)
MVKSQPILRYILRVAPAIAVAVLLSACSSNSTARNMHSETLAVGSGDLSSLQASQDEFET
MVRNLDVKSRLMDQYASWKGVRYRLGGSTRKGIDCSAFVQRTFREQFGLELPRSTSEQQD
SGKSISRAQLRTGDLVLFRAGSTGRHVGIYIGNNQFVHASTSSGVTISSMDEPYWKKRYN
EARRVLSRS