Protein Info for BWI76_RS19720 in Klebsiella michiganensis M5al

Annotation: pseudouridine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 PF00294: PfkB" amino acids 5 to 295 (291 residues), 202.3 bits, see alignment E=5.7e-64

Best Hits

Swiss-Prot: 75% identical to PSUK_ECOLI: Pseudouridine kinase (psuK) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 84% identity to esc:Entcl_1538)

MetaCyc: 76% identical to pseudouridine kinase (Escherichia coli UTI89)
Pseudouridine kinase. [EC: 2.7.1.83]

Predicted SEED Role

"Pseudouridine kinase (EC 2.7.1.83)" (EC 2.7.1.83)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.83

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B6Y2 at UniProt or InterPro

Protein Sequence (311 amino acids)

>BWI76_RS19720 pseudouridine kinase (Klebsiella michiganensis M5al)
MPENDYVVIIGSANMDVAGYSNVSLNYADSNPGKIKYTPGGVGRNIAQNIALLNKTAWLL
SVVGDDFYGHSLLKQTAQSGVHVDKCQIIPGEGTSSYLSLLDNTGEMLVAINDMSITEHI
TPAFLRQHQDFICGAAVIVVDCNISESALAWLMENSGSTPIFVDPVSAWKCVKISQHLGR
IHTLKPNRIEAETLSGIALSGTDDVARVADWFHHHGLKRLVLSMGGDGVYYSERDGERGW
SAPLKTQVVNVTGAGDAMMAGLACCWLDGCSFSQAVKFAQGCSSLALSSEFTNNPELSYA
NVKKVVEKEYV