Protein Info for BWI76_RS19355 in Klebsiella michiganensis M5al

Annotation: LacI family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 PF01381: HTH_3" amino acids 2 to 41 (40 residues), 23.2 bits, see alignment 1.4e-08 PF00532: Peripla_BP_1" amino acids 65 to 223 (159 residues), 39.6 bits, see alignment E=1.1e-13 PF13407: Peripla_BP_4" amino acids 67 to 276 (210 residues), 55.3 bits, see alignment E=1.9e-18

Best Hits

KEGG orthology group: None (inferred from 92% identity to kpn:KPN_02545)

Predicted SEED Role

"Ribitol operon repressor" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B6E6 at UniProt or InterPro

Protein Sequence (333 amino acids)

>BWI76_RS19355 LacI family transcriptional regulator (Klebsiella michiganensis M5al)
MKKITIYDLAELSGVSASAVSAILNGNWKKRRISAKLAEKVTRIAEEQGYAINRQASMLR
SKKSHVIGMIVPKYDNRYFGSVAERFEEMARERSLLPIITCTRRSPELEIEAVKAMLSWQ
VDWVVATGATNPDKITALCQQAGVPVVNLDLPGSLAPSVISDNYGGAKALTHKILANSAG
RRGTLAPLTFIGGRSGDHNTSERLRGFHDAHRERGLSVPQENILAPGYSKGKVEACLQAR
FGAANTSLPGIFVNSTISLEGVVRWLSQAGLTGSEQPPMGCFDWDPFVYLLGHDIDMVQQ
DVPAMLEAVFQIIDSGDASQQRIEIPPLLMSSR