Protein Info for BWI76_RS19305 in Klebsiella michiganensis M5al

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 PF00005: ABC_tran" amino acids 35 to 191 (157 residues), 78.6 bits, see alignment E=7.3e-26

Best Hits

Swiss-Prot: 50% identical to Y4TR_SINFN: Probable peptide ABC transporter ATP-binding protein y4tR (NGR_a01410) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K02031, peptide/nickel transport system ATP-binding protein (inferred from 96% identity to kva:Kvar_1528)

Predicted SEED Role

"Dipeptide transport ATP-binding protein DppD (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B6D6 at UniProt or InterPro

Protein Sequence (287 amino acids)

>BWI76_RS19305 ABC transporter ATP-binding protein (Klebsiella michiganensis M5al)
MTSSILAASNAPLLDVRDLCVDFVNGSAVTHAVRGVSFQLGREKLAIVGESGSGKSTVGR
ALLQLHPKKARVTAARMQFADLDLRHLSEAQMRGVRGKRISMIMQDPKYSLNPVVCVGKQ
IAEAWLTHHPGRKDEAKAKALEMLEVVRIRQPERVYQLYPHEISGGQGQRIMIAMMLITD
PELVIADEPTSALDVSVRLQVLGLLDDLVQSRGLGLIFISHDINLVRSFCDRVLVMYAGR
VVESIAAKDLDNARHPYTQGLINSLPDMQHRRPILPVLQRQASWLTE