Protein Info for BWI76_RS19270 in Klebsiella michiganensis M5al

Annotation: two-component sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 511 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 211 to 231 (21 residues), see Phobius details PF00672: HAMP" amino acids 229 to 279 (51 residues), 53.4 bits, see alignment 3.9e-18 PF00512: HisKA" amino acids 284 to 348 (65 residues), 49.8 bits, see alignment E=4.5e-17 PF02518: HATPase_c" amino acids 393 to 504 (112 residues), 86.5 bits, see alignment E=2.5e-28

Best Hits

KEGG orthology group: K07642, two-component system, OmpR family, sensor histidine kinase BaeS [EC: 2.7.13.3] (inferred from 84% identity to kva:Kvar_1533)

Predicted SEED Role

"Sensory histidine kinase BaeS"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B6F2 at UniProt or InterPro

Protein Sequence (511 amino acids)

>BWI76_RS19270 two-component sensor histidine kinase (Klebsiella michiganensis M5al)
MKFWRPGITGKLFIAILATCIVLLISMHWAVRISFERGFIDYIKRGNEQRLTMLGDALSE
QYAQHGSWTFLRNNDRFIFQLLKTFERDNDDRSPPGRGMGHGPRDEPHGGPGPEEMPPDA
APDRPLDGPRGDRGDRGPGPDMPPHGWRTMFWVVDQKGRVLVGPRERVPQDGTRRSIMVD
GVEVGAVIASPVERLTRNTDINFDRQQKRTSWLIVALATLLAALATFPLARGLLAPVKRL
VDGTHRLAAGDFSTRVAATSSDELGRLAKDFNQLASTLERNQQMRRDLMADISHELRTPL
AVLRGELEAIQDGIRKFTPDSIASLQAEVATLTKLVDDLHQLSMSDEGALSYQKSAVDII
NLLEVAAGAFRERFASRGLSIGVSLPESATVFGDRDRLMQLFNNLLENSLRYTDSGGGLQ
ISASQSGDRLILDFADSAPGVTDEQLERLVERFYRTEGSRNRASGGSGLGLAICLNIVAA
HGGTLRVGHSPLGGVSIKVELPLERNLSRDV