Protein Info for BWI76_RS19265 in Klebsiella michiganensis M5al

Annotation: multidrug transporter subunit MdtD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 471 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 45 to 68 (24 residues), see Phobius details amino acids 76 to 96 (21 residues), see Phobius details amino acids 102 to 123 (22 residues), see Phobius details amino acids 133 to 154 (22 residues), see Phobius details amino acids 163 to 185 (23 residues), see Phobius details amino acids 197 to 214 (18 residues), see Phobius details amino acids 220 to 242 (23 residues), see Phobius details amino acids 263 to 281 (19 residues), see Phobius details amino acids 287 to 308 (22 residues), see Phobius details amino acids 329 to 355 (27 residues), see Phobius details amino acids 393 to 416 (24 residues), see Phobius details amino acids 431 to 451 (21 residues), see Phobius details PF07690: MFS_1" amino acids 15 to 405 (391 residues), 161.7 bits, see alignment E=2.3e-51 amino acids 269 to 456 (188 residues), 47.5 bits, see alignment E=1.3e-16 TIGR00711: drug resistance MFS transporter, drug:H+ antiporter-2 (14 Spanner) (DHA2) family" amino acids 16 to 423 (408 residues), 234 bits, see alignment E=1.7e-73 PF05977: MFS_3" amino acids 25 to 171 (147 residues), 32.7 bits, see alignment E=2.9e-12

Best Hits

Swiss-Prot: 89% identical to MDTD_KLEP7: Putative multidrug resistance protein MdtD (mdtD) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: None (inferred from 89% identity to kpn:KPN_02529)

Predicted SEED Role

"Multidrug transporter MdtD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B6Q0 at UniProt or InterPro

Protein Sequence (471 amino acids)

>BWI76_RS19265 multidrug transporter subunit MdtD (Klebsiella michiganensis M5al)
MTDLPSSVRWQLWIVAFGFFMQALDTTIVNTALPSMAKSLGESPLHMHMVIVSYVLTVAV
MLPASGWLADRVGVRNIFFCAIVLFTAGSLFCAQAATLDGLILARVLQGVGGAMMVPVGR
LTVMKIVPRSQYMAAMTFVTLPGQVGPLLGPALGGMLVEYASWHWIFLINIPVGIVGAIA
TLCLMPNYTLQTRRFDLFGFVLLAAGMATLTLALDGNKGLGISPLWLAGLVAVGVASILY
YLRHARGNRNALFSLKLFNNRTFSLGLGGSFAGRIGSGMLPFMTPVFLQIGLGFTPFHAG
LMMIPMVLGSMGMKRIVVQVVNRFGYRRVLVASTIGLALVSLLFMAVALAGWYWLLPVVL
FMQGMINASRFSSMNTLTLKDLPDDLASSGNSLLSMVMQLSMSIGVTVAGMLLGFYGQQH
ISADAPTTHQVFLYTYLSMAVVIALPALIFARVPDDTTVNTVIRRRKRSES