Protein Info for BWI76_RS19175 in Klebsiella michiganensis M5al

Annotation: dicarboxylate/amino acid:cation symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 424 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 51 to 72 (22 residues), see Phobius details amino acids 84 to 105 (22 residues), see Phobius details amino acids 153 to 171 (19 residues), see Phobius details amino acids 192 to 221 (30 residues), see Phobius details amino acids 227 to 249 (23 residues), see Phobius details amino acids 296 to 320 (25 residues), see Phobius details amino acids 326 to 344 (19 residues), see Phobius details amino acids 355 to 378 (24 residues), see Phobius details PF00375: SDF" amino acids 7 to 403 (397 residues), 338.3 bits, see alignment E=3.3e-105

Best Hits

Swiss-Prot: 38% identical to DCTA_SPHWW: C4-dicarboxylate transport protein (dctA) from Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273)

KEGG orthology group: None (inferred from 92% identity to kpu:KP1_3740)

Predicted SEED Role

"C4-dicarboxylate transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B6M4 at UniProt or InterPro

Protein Sequence (424 amino acids)

>BWI76_RS19175 dicarboxylate/amino acid:cation symporter (Klebsiella michiganensis M5al)
MASANKLTLFIVIFMLLGILSGAAIHAYAGQTTITAWSENITLLTDVFLRLIKMVIAPLV
FSTLTVGIMRLGETATIGRVGGKAMVWFITSSILSILVGLVIVTLEHPGAGLNLAIPKES
VDTGLAVSGMSLKGFLTHTIPTSITEAMASNEILQIVVFSMFFGIAGASLGEKFNAPLVA
ALNVVSHIMLKVTGYVMYVAPLAIFAAISSVIASQGLGILLNYASFIGGYYVAILLTSAV
LLAVGYMVLKKEVFRLLNMLKDPVLVAFTTSSSEAAYPKTLERLVEFGCSRNIASFVLPI
GYSFNLVGSMVYCSFAAMFIAQAYNVQLSFSEITVMMLTLMLASKGIAGVPRSALVVLAA
TIPSFNIPVAGILLLMGIDHFLDMGRSAINVLGNGIATAMLSKNEGQLQEEVLEAEAAPQ
QAEA