Protein Info for BWI76_RS19110 in Klebsiella michiganensis M5al

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 528 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 48 to 69 (22 residues), see Phobius details amino acids 84 to 103 (20 residues), see Phobius details amino acids 124 to 148 (25 residues), see Phobius details amino acids 154 to 172 (19 residues), see Phobius details amino acids 184 to 206 (23 residues), see Phobius details amino acids 213 to 233 (21 residues), see Phobius details PF03741: TerC" amino acids 14 to 203 (190 residues), 164 bits, see alignment E=4.5e-52 PF00571: CBS" amino acids 302 to 358 (57 residues), 23.3 bits, see alignment 9.8e-09 amino acids 373 to 422 (50 residues), 30.5 bits, see alignment 5.6e-11 PF03471: CorC_HlyC" amino acids 440 to 516 (77 residues), 74 bits, see alignment E=1.2e-24

Best Hits

Swiss-Prot: 85% identical to YEGH_ECOLI: UPF0053 protein YegH (yegH) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 90% identity to eae:EAE_23555)

Predicted SEED Role

"Putative capsular polysaccharide transport protein YegH"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B6J1 at UniProt or InterPro

Protein Sequence (528 amino acids)

>BWI76_RS19110 hypothetical protein (Klebsiella michiganensis M5al)
MEWIADPSIWAGLITLVVIELVLGIDNLVFIAILAEKLPPAQRDRARVTGLLLAMVMRLL
LLASISWLVTLTRPLITWHDLSFSARDLIMLFGGLFLLFKATVELNERLEGKDSDNPTQR
KGARFWGVVAQIVVLDAIFSLDSVITAVGMVDHLAVMMAAVIIAISLMLMASKALTRFVN
SHPTIVILCLSFLLMIGFSLIAEGFGFPIPKGYLYAAIGFSVMIESFNQLAIFNRHRFLS
ANLTLRQRTTEAVMNLLSGHKENNELDSDTASLVADRDDNPLFNPQERRMIERVLNLNQR
TVSSIMTSRHDIEYIDLSAPEEEIRALLDKNQHTRLVVTGVDDDEDMLGVVHVIDLLQQS
LRHEPLNLQALIRQPLVFPETLPLLPALEQFRKARTHFAFVVDEFGSVEGIVTLSDVMET
IAGNLPNEVEEIDARHDIHKNGDGSWTVNGHMPLEDLVQYVPLPLDEKREYHTVAGLLME
YLQHVPQEGEEVNLDGYVLRTLQVESHRVQKVQIVPPAHNEDELDYEV