Protein Info for BWI76_RS19005 in Klebsiella michiganensis M5al

Annotation: capsular polysaccharide biosynthesis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 transmembrane" amino acids 303 to 318 (16 residues), see Phobius details PF13641: Glyco_tranf_2_3" amino acids 8 to 212 (205 residues), 50.2 bits, see alignment E=4.9e-17 PF10111: Glyco_tranf_2_2" amino acids 10 to 101 (92 residues), 38.8 bits, see alignment E=1.2e-13 PF00535: Glycos_transf_2" amino acids 10 to 130 (121 residues), 112.9 bits, see alignment E=2.3e-36

Best Hits

KEGG orthology group: None (inferred from 53% identity to eae:EAE_23465)

Predicted SEED Role

"Beta-1,3-glucosyltransferase" in subsystem LOS core oligosaccharide biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (328 amino acids)

>BWI76_RS19005 capsular polysaccharide biosynthesis protein (Klebsiella michiganensis M5al)
MRDTNLPTLSVVIPVYNVSKYVLEAIDSVINQTITPFEVIIVDDGSTDNSGELVEQYYSE
IQYVKIIHTHNQGLGEARNVGTRAALGEYIYYFDSDDVLQLYLIEDFYNALKSNGELDIF
AFSAESFLDGADKEMVAPQNKLPKYLRVHETLFSSGGEAFIEMSRTGTFYPNAWLYIFRR
KFFTDFNITFKSIIHEDEEFTPRLFLHAGKTFITRKCFFKRRVRAGSIMQSSRSEKNIIG
YIESINALEVLLASHDGEIKKYLRARLIENILNILVIQKSNNIVLTTQTSQRVRALLKKY
KTFYIFLAQHNFFVYRVVKFVMRKFGCK