Protein Info for BWI76_RS18415 in Klebsiella michiganensis M5al

Annotation: very short patch repair endonuclease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 164 TIGR00632: DNA mismatch endonuclease Vsr" amino acids 1 to 118 (118 residues), 161 bits, see alignment E=6.8e-52 PF03852: Vsr" amino acids 2 to 74 (73 residues), 110.9 bits, see alignment E=1.1e-36

Best Hits

Swiss-Prot: 83% identical to VSR_ECOLI: Very short patch repair protein (vsr) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 81% identity to eae:EAE_23105)

Predicted SEED Role

"Very-short-patch mismatch repair endonuclease (G-T specific)" in subsystem DNA repair, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B5Z6 at UniProt or InterPro

Protein Sequence (164 amino acids)

>BWI76_RS18415 very short patch repair endonuclease (Klebsiella michiganensis M5al)
MADVHDKATRSKNMRAIGTRDTAIEKRLAGLLARAGFSFTVQDAALPGRPDFVVAEYQCV
IFTHGCFWHHHNCYLFKVPATRTEFWLDKIAKNVARDRRDIGLLAEQGWRVLVVWECALR
GRQKLSDEALGERLEEWICGGGNCAQIDTQGIGLLDVTSAPYRR