Protein Info for BWI76_RS18410 in Klebsiella michiganensis M5al

Annotation: drug/metabolite exporter YedA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 transmembrane" amino acids 7 to 31 (25 residues), see Phobius details amino acids 37 to 56 (20 residues), see Phobius details amino acids 68 to 88 (21 residues), see Phobius details amino acids 95 to 117 (23 residues), see Phobius details amino acids 124 to 143 (20 residues), see Phobius details amino acids 149 to 169 (21 residues), see Phobius details amino acids 179 to 199 (21 residues), see Phobius details amino acids 211 to 233 (23 residues), see Phobius details amino acids 244 to 262 (19 residues), see Phobius details amino acids 268 to 290 (23 residues), see Phobius details PF00892: EamA" amino acids 12 to 140 (129 residues), 68.8 bits, see alignment E=3e-23 amino acids 150 to 284 (135 residues), 67 bits, see alignment E=1.1e-22

Best Hits

Swiss-Prot: 82% identical to YEDA_ECO57: Uncharacterized inner membrane transporter YedA (yedA) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 90% identity to kpe:KPK_1852)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B5R4 at UniProt or InterPro

Protein Sequence (303 amino acids)

>BWI76_RS18410 drug/metabolite exporter YedA (Klebsiella michiganensis M5al)
MSTRQLLPLIGALFALYIIWGSTYFAIAVGVASWPPLMMAGVRFLSAGAVLTAWLLATGH
KLPARKPLLNAALIGVLLLAVGNGFVTLAEHQHVPSGIAAVMVATVPLFTLCFSRFFGIA
TRKLEWLGIAIGLAGIVLLNSGGNLNGNPWGALLILIGSMSWAFGSVYGSRIELPTGMMA
GAIEMLAAGVVLMIASTLTGEKLTQMPSWSGIFAVAYLAIFGSLIAINAYMYLIRNVTPA
VATSYAYVNPVVAVLLGTGFAGESLSAVEWLALGIIIFAVVLVTLGKYLLPARRDITSCK
AQK