Protein Info for BWI76_RS18345 in Klebsiella michiganensis M5al
Annotation: transcriptional regulator SdiA
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 64% identical to SDIA_ECOLI: Regulatory protein SdiA (sdiA) from Escherichia coli (strain K12)
KEGG orthology group: K07782, LuxR family transcriptional regulator (inferred from 85% identity to kpu:KP1_3544)Predicted SEED Role
"N-3-oxohexanoyl-L-homoserine lactone quorum-sensing transcriptional activator @ N-3-oxooctanoyl-L-homoserine lactone quorum-sensing transcriptional activator"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A285B5T5 at UniProt or InterPro
Protein Sequence (240 amino acids)
>BWI76_RS18345 transcriptional regulator SdiA (Klebsiella michiganensis M5al) MRDNDFFSWRREMLQQFQSVSAGEGVFHLLQQQAKGLEYDYFALCVRHPVPFTRPRVTLQ STYPQAWMAHYQAENYFAIDPVLRKENFLRGHLPWNDKLFNDTPELWNGARDHGLRKGVT QCLTLPNHAQGFLSVSGASHSQGPFAEDELEMRLRTLTELSLLTLLRLEDEMVMPPEMKF SRRELEILKWTAEGKTSAEVAMILSISENTVNFHQKNMQRKFNAPNKTQIACYAVATGLI