Protein Info for BWI76_RS18345 in Klebsiella michiganensis M5al

Annotation: transcriptional regulator SdiA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 240 PF03472: Autoind_bind" amino acids 24 to 160 (137 residues), 105.3 bits, see alignment E=2.2e-34 PF00196: GerE" amino acids 179 to 234 (56 residues), 75.7 bits, see alignment E=1.7e-25

Best Hits

Swiss-Prot: 64% identical to SDIA_ECOLI: Regulatory protein SdiA (sdiA) from Escherichia coli (strain K12)

KEGG orthology group: K07782, LuxR family transcriptional regulator (inferred from 85% identity to kpu:KP1_3544)

Predicted SEED Role

"N-3-oxohexanoyl-L-homoserine lactone quorum-sensing transcriptional activator @ N-3-oxooctanoyl-L-homoserine lactone quorum-sensing transcriptional activator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B5T5 at UniProt or InterPro

Protein Sequence (240 amino acids)

>BWI76_RS18345 transcriptional regulator SdiA (Klebsiella michiganensis M5al)
MRDNDFFSWRREMLQQFQSVSAGEGVFHLLQQQAKGLEYDYFALCVRHPVPFTRPRVTLQ
STYPQAWMAHYQAENYFAIDPVLRKENFLRGHLPWNDKLFNDTPELWNGARDHGLRKGVT
QCLTLPNHAQGFLSVSGASHSQGPFAEDELEMRLRTLTELSLLTLLRLEDEMVMPPEMKF
SRRELEILKWTAEGKTSAEVAMILSISENTVNFHQKNMQRKFNAPNKTQIACYAVATGLI