Protein Info for BWI76_RS18295 in Klebsiella michiganensis M5al

Annotation: tyrosine transporter TyrP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 39 to 58 (20 residues), see Phobius details amino acids 78 to 100 (23 residues), see Phobius details amino acids 121 to 142 (22 residues), see Phobius details amino acids 150 to 169 (20 residues), see Phobius details amino acids 182 to 206 (25 residues), see Phobius details amino acids 217 to 235 (19 residues), see Phobius details amino acids 276 to 299 (24 residues), see Phobius details amino acids 310 to 330 (21 residues), see Phobius details amino acids 336 to 356 (21 residues), see Phobius details amino acids 377 to 400 (24 residues), see Phobius details PF03222: Trp_Tyr_perm" amino acids 1 to 390 (390 residues), 455.4 bits, see alignment E=2e-140 PF01490: Aa_trans" amino acids 7 to 162 (156 residues), 31.1 bits, see alignment E=1.1e-11 TIGR00837: aromatic amino acid transport protein" amino acids 7 to 384 (378 residues), 452.8 bits, see alignment E=5.8e-140

Best Hits

Swiss-Prot: 79% identical to TYRP_ECOLI: Tyrosine-specific transport protein (tyrP) from Escherichia coli (strain K12)

KEGG orthology group: K03834, tyrosine-specific transport protein (inferred from 92% identity to kva:Kvar_1701)

Predicted SEED Role

"Tyrosine-specific transport protein" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B5W0 at UniProt or InterPro

Protein Sequence (403 amino acids)

>BWI76_RS18295 tyrosine transporter TyrP (Klebsiella michiganensis M5al)
MKNRTLGSILIVAGTTIGAGMLAMPLASAGVGFGVTLGLLITLWALMCYTALLLLEVYQH
VPADMGLGSLAARYLGRYGQWATGFCMLFLLYALTAAYISGAGELLASSLNQWLDWRLPP
AAGVLIFTGIGGTVVCIGTSLVDLFNRFLFSAKIIFLAIMLALLLPHIHQINLLTLPLQQ
GLALSAIPVIFTSFGFHGSIPSIVSYLGGDIRKLRRVFVIGSFIPLVAYIFWQLATLGSI
DSPVFTALLAKNAGLNGLLEAIREVVASAHVELAVHLFADLALATSFLGVALGLFDYLAD
LFQRQNSAAGRLQSGLITFLPPLAFALFYPRGFVMALGYAGVALAVLALMLPSLLVMKSR
QQHPDAAWRVAGGSPALWLVLLCGIGIVAIQFAIVAGLLPAVG