Protein Info for BWI76_RS18165 in Klebsiella michiganensis M5al

Annotation: NUDIX pyrophosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 147 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details PF00293: NUDIX" amino acids 5 to 141 (137 residues), 70.1 bits, see alignment E=9.7e-24

Best Hits

Swiss-Prot: 84% identical to NUDB_ECO57: Dihydroneopterin triphosphate diphosphatase (nudB) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 94% identity to eae:EAE_22870)

MetaCyc: 84% identical to dihydroneopterin triphosphate diphosphatase (Escherichia coli K-12 substr. MG1655)
3.6.1.M7,3.6.1.9 [EC: 3.6.1.9, 3.6.1.M7]; H2NEOPTERINP3PYROPHOSPHOHYDRO-RXN [EC: 3.6.1.9, 3.6.1.M7, 3.6.1.67]

Predicted SEED Role

"Dihydroneopterin triphosphate pyrophosphohydolase type 2" in subsystem Folate Biosynthesis or Queuosine-Archaeosine Biosynthesis

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.67 or 3.6.1.9 or 3.6.1.M7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B5M1 at UniProt or InterPro

Protein Sequence (147 amino acids)

>BWI76_RS18165 NUDIX pyrophosphatase (Klebsiella michiganensis M5al)
MSFKLPVSVLVVIYAKDTKRVLMLQRRDDPAFWQSVTGSLEEGETAPQAAAREVMEEVAI
DVASEQLALVDCQRTVEFEIFSHLRHRYAPGVERNTEFWFRLALPHERQIVFTEHLDYRW
VDAAEAATLTKSWSNRQAIEEFVINAA