Protein Info for BWI76_RS18165 in Klebsiella michiganensis M5al

Annotation: NUDIX pyrophosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00293: NUDIX
  • amino acids 5 to 141 (137 residues), 70.1 bits, E=9.7e-24

Best Hits

Swiss-Prot: 84% identical to NUDB_ECO57: Dihydroneopterin triphosphate diphosphatase (nudB) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 94% identity to eae:EAE_22870)

MetaCyc: 84% identical to dihydroneopterin triphosphate diphosphatase (Escherichia coli K-12 substr. MG1655)
3.6.1.M7,3.6.1.9 [EC: 3.6.1.9, 3.6.1.M7]; H2NEOPTERINP3PYROPHOSPHOHYDRO-RXN [EC: 3.6.1.9, 3.6.1.M7, 3.6.1.67]

Predicted SEED Role

"Dihydroneopterin triphosphate pyrophosphohydolase type 2" in subsystem Folate Biosynthesis or Queuosine-Archaeosine Biosynthesis

MetaCyc Pathways

• superpathway of chorismate metabolism (54/59 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (18/18 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (14/14 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis I (9/9 steps found)
• superpathway of tetrahydrofolate biosynthesis and salvage (11/12 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis II (7/7 steps found)
• superpathway of tetrahydrofolate biosynthesis (9/10 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis III (8/9 steps found)
• pyrimidine deoxyribonucleotides dephosphorylation (3/3 steps found)
• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis I (4/5 steps found)
• dZTP biosynthesis (3/5 steps found)
• tunicamycin biosynthesis (2/9 steps found)

KEGG Metabolic Maps

• Nicotinate and nicotinamide metabolism
• Pantothenate and CoA biosynthesis
• Purine metabolism
• Riboflavin metabolism
• Starch and sucrose metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.67 or 3.6.1.9 or 3.6.1.M7

Sequence Analysis Tools

See A0A285B5M1 at UniProt or InterPro

Protein Sequence (147 amino acids)

>BWI76_RS18165 NUDIX pyrophosphatase (Klebsiella michiganensis M5al)
MSFKLPVSVLVVIYAKDTKRVLMLQRRDDPAFWQSVTGSLEEGETAPQAAAREVMEEVAI
DVASEQLALVDCQRTVEFEIFSHLRHRYAPGVERNTEFWFRLALPHERQIVFTEHLDYRW
VDAAEAATLTKSWSNRQAIEEFVINAA