Protein Info for BWI76_RS18135 in Klebsiella michiganensis M5al

Annotation: zinc ABC transporter ATP-binding protein ZnuC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 20 to 149 (130 residues), 103.9 bits, E=1.2e-33

Best Hits

Swiss-Prot: 89% identical to ZNUC_SHISS: Zinc import ATP-binding protein ZnuC (znuC) from Shigella sonnei (strain Ss046)

KEGG orthology group: K09817, zinc transport system ATP-binding protein [EC: 3.6.3.-] (inferred from 93% identity to kpe:KPK_1911)

MetaCyc: 89% identical to Zn2+ ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-63-RXN [EC: 7.2.2.20]

Predicted SEED Role

"Zinc ABC transporter, ATP-binding protein ZnuC" in subsystem Transport of Zinc

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.- or 7.2.2.20

Sequence Analysis Tools

See A0A285B5W9 at UniProt or InterPro

Protein Sequence (250 amino acids)

>BWI76_RS18135 zinc ABC transporter ATP-binding protein ZnuC (Klebsiella michiganensis M5al)
MTNLVTLENVAVVYGQRRVLSDISLTLKPGKILTLLGPNGAGKSTLVRVVLGLVAPTEGV
IKREGHLRIGYVPQKLHLDATMPLTVSRFMLLRPGTHKRDILPALKRVQAGHLIDAPMQK
LSGGETQRVLLARALLNQPQLLVLDEPTQGVDVNGQVALYDLINQLRQELNCAVLMVSHD
LHLVMAKTDEVLCLNQHICCSGAPEVVSMHPEFISMFGQRGAEQLGIYRHHHNHRHDLQG
RIVLRRGNDR