Protein Info for BWI76_RS18015 in Klebsiella michiganensis M5al

Annotation: serine/threonine-protein phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 217 PF00149: Metallophos" amino acids 12 to 168 (157 residues), 59.3 bits, see alignment E=3.6e-20

Best Hits

Swiss-Prot: 61% identical to PRP1_ECOLI: Serine/threonine-protein phosphatase 1 (pphA) from Escherichia coli (strain K12)

KEGG orthology group: K07313, serine/threonine protein phosphatase 1 [EC: 3.1.3.16] (inferred from 75% identity to kpu:KP1_3481)

MetaCyc: 61% identical to phosphoprotein phosphatase 1 (Escherichia coli K-12 substr. MG1655)
Protein-tyrosine-phosphatase. [EC: 3.1.3.48]; Phosphoprotein phosphatase. [EC: 3.1.3.48, 3.1.3.16]

Predicted SEED Role

"Ren protein"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.48

Use Curated BLAST to search for 3.1.3.16 or 3.1.3.48

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B625 at UniProt or InterPro

Protein Sequence (217 amino acids)

>BWI76_RS18015 serine/threonine-protein phosphatase (Klebsiella michiganensis M5al)
MYQRINGSAWRNIWLVGDLHGCFARLMAALRERRFDPYQDLLLSVGDLIDRGPQSAQCLD
LLRYRWVCAVRGNHEQMALEALAGGDMRLWEMNGGGWYTQSPQNQRRRLAELIASCRDLP
LIIELHSGGQVHVIAHADYPAAVYRWQRAVDEHQVLWRRQRLTDHFAGRHGAIAGADHFW
FGHTPLQRRYDSDNQHYIDTGAVFGGELTLVALQLAG