Protein Info for BWI76_RS18000 in Klebsiella michiganensis M5al

Annotation: 16S rRNA (cytosine(1407)-C(5))-methyltransferase RsmF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 491 PF17125: Methyltr_RsmF_N" amino acids 22 to 119 (98 residues), 96.6 bits, see alignment E=2e-31 TIGR00446: NOL1/NOP2/sun family putative RNA methylase" amino acids 55 to 324 (270 residues), 355 bits, see alignment E=1.1e-110 PF01189: Methyltr_RsmB-F" amino acids 132 to 323 (192 residues), 157.2 bits, see alignment E=8.6e-50 PF21150: YebU_pre-PUA_dom" amino acids 343 to 419 (77 residues), 132.2 bits, see alignment E=9.7e-43 PF13636: Methyltranf_PUA" amino acids 433 to 481 (49 residues), 46.4 bits, see alignment 6.8e-16

Best Hits

Swiss-Prot: 85% identical to RSMF_KLEP3: Ribosomal RNA small subunit methyltransferase F (rsmF) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: None (inferred from 87% identity to eae:EAE_22700)

MetaCyc: 78% identical to 16S rRNA m5C1407 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11593 [EC: 2.1.1.178]

Predicted SEED Role

"Ribosomal RNA small subunit methyltransferase F (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.178

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B5P9 at UniProt or InterPro

Protein Sequence (491 amino acids)

>BWI76_RS18000 16S rRNA (cytosine(1407)-C(5))-methyltransferase RsmF (Klebsiella michiganensis M5al)
MVNYAPFFPCGALPVAQNAVYLPEEFLAQMRSAMPTHLSFDDFIAACQRPLRRSIRVNTL
KITVADFLQLVAPYRWQLTPVPWCEEGFWIEREDEDDLPLGSTAEHLSGLFYIQEASSML
PVAALFADGETPQRLMDVAAAPGSKTTQIAARMGNEGGILANEYSASRVKVLHANISRCG
ISNVALTHFDGRVFGAALPECFDAILLDAPCSGEGVVRKDPDALKNWSPESNAEIALTQR
ELIDSAFHALRPGGMLVYSTCTLNRQENEEVVNGLLARYPQAVQVLPLGSLFPQASEALT
DEGFLHVFPQIFDCEGFFVARLRKTAAIEPLPAPGYKVGKFPFTPLKTRESAAVIAAAAA
VGLQWSAEHTLWQRDKEIWLFPQALEALFGKVRFSRIGIRLAETHNKGYRWQHEAVIALA
APAAPFALTQAEAEEWYRGRDVYPETLPEKDDAIVTYQGAPLGLAKKVGSRLKNSYPREL
VRDGKLFSKKA