Protein Info for BWI76_RS17880 in Klebsiella michiganensis M5al

Annotation: c-di-GMP phosphodiesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 521 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details transmembrane" amino acids 245 to 264 (20 residues), see Phobius details PF12792: CSS-motif" amino acids 43 to 235 (193 residues), 91.9 bits, see alignment E=3.8e-30 PF00563: EAL" amino acids 273 to 501 (229 residues), 195.6 bits, see alignment E=8.7e-62

Best Hits

Swiss-Prot: 59% identical to PDED_ECOLI: Probable cyclic di-GMP phosphodiesterase PdeD (pdeD) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 79% identity to eae:EAE_22595)

Predicted SEED Role

"Rtn protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B5H6 at UniProt or InterPro

Protein Sequence (521 amino acids)

>BWI76_RS17880 c-di-GMP phosphodiesterase (Klebsiella michiganensis M5al)
MQTAQKVITTYRRKRILVCLLVALLTLTTTLVIRFISQRSLNQQRVQMSTNKMVAAMDNI
LRPLAAQHVALLHLVNKPCQDVHLTLRKLAASLQTVRSIALVQSNLLYCSSIFGQRNIPI
HQLQPALPTHHPLLTFSYDASLLKGTPVLIQWYPASLSGADGVLLVINIELLGELIFNAK
SALISGIGLNVGERSFISGSGLSKQEALPGEQIIYRQPSTEFPFTISVSGPGASAVALNE
LPAELPLALVISLLMTGIAWLATAGRMSFSREINLGIAAHEFALWCQPLQNLRTRQCCGV
EILLRWNNPRRGEISPDVFIPIAEGYNLIVPLTRYVISQTAHKLACFPQDKHFHISINVA
ARHFANGELLRDLHHYWFSAHPIQQLVVELTERDVLQDGDHHMAEHLHFKGVQLAIDDFG
TGNSSLSWLEKLRPDVLKIDKSFTSAIGIDSVNATVTDMIIALAHRLKIVTVAEGVETQD
QEAYLRGNGVDLLQGFYYARPMPVEDFPQWLAAEKRREMNA