Protein Info for BWI76_RS17835 in Klebsiella michiganensis M5al

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 279 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 68 to 94 (27 residues), see Phobius details amino acids 102 to 128 (27 residues), see Phobius details amino acids 142 to 164 (23 residues), see Phobius details amino acids 185 to 210 (26 residues), see Phobius details amino acids 245 to 264 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 88 to 272 (185 residues), 73.5 bits, see alignment E=9.6e-25

Best Hits

Swiss-Prot: 31% identical to ARAQ_BACHD: L-arabinose transport system permease protein AraQ (araQ) from Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)

KEGG orthology group: K02026, multiple sugar transport system permease protein (inferred from 98% identity to kva:Kvar_1860)

Predicted SEED Role

"ABC type sugar transport system, permease protein precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B5M2 at UniProt or InterPro

Protein Sequence (279 amino acids)

>BWI76_RS17835 sugar ABC transporter permease (Klebsiella michiganensis M5al)
MLSKRWDTAGRWCIYALLLIVFVGPFWGIVATAFSGAPVKPGELLAWPNQFSFENFIFAW
MDIGVWQYLLNSILVVFFGTVLQVSVSALAAYALARKKFRGVALVSLVILSTMMLPEEVI
AIPLYMIINWRLPFIDASLYNSYLGMILPVVGWAFSIFVLTEFMSAIPKELEEAARIDGA
NEWQIFFHVILPLVKPALGTVVTFGFIMIWDQYLLPLIVVNQDSLNTIPVILGTLRTDES
ITPNIFIAITLLAMLPSIIVYLGLQKHFNRGIMSGAVKG