Protein Info for BWI76_RS17810 in Klebsiella michiganensis M5al

Annotation: tRNA N6-adenosine(37)-N6-threonylcarbamoyltransferase complex dimerization subunit TsaB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 231 TIGR03725: tRNA threonylcarbamoyl adenosine modification protein YeaZ" amino acids 3 to 219 (217 residues), 232.1 bits, see alignment E=3.4e-73 PF00814: TsaD" amino acids 28 to 133 (106 residues), 104.7 bits, see alignment E=3.7e-34

Best Hits

Swiss-Prot: 81% identical to TSAB_ECOLI: tRNA threonylcarbamoyladenosine biosynthesis protein TsaB (tsaB) from Escherichia coli (strain K12)

KEGG orthology group: K14742, hypothetical protease [EC: 3.4.-.-] (inferred from 91% identity to kva:Kvar_1865)

MetaCyc: 81% identical to N6-L-threonylcarbamoyladenine synthase, TsaB subunit (Escherichia coli K-12 substr. MG1655)
RXN-14570 [EC: 2.3.1.234]

Predicted SEED Role

"TsaB protein, required for threonylcarbamoyladenosine (t(6)A) formation in tRNA"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.4.-.-

Use Curated BLAST to search for 2.3.1.234 or 3.4.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B5N6 at UniProt or InterPro

Protein Sequence (231 amino acids)

>BWI76_RS17810 tRNA N6-adenosine(37)-N6-threonylcarbamoyltransferase complex dimerization subunit TsaB (Klebsiella michiganensis M5al)
MRILAIDTATEACSAALWNDGTLSAHFEICPREHTQRILPLVQEVLNESGTQLTDLDALA
FGRGPGSFTGVRIGIGIAQGLALGAELPMIGVSTLATMAQGAWRKTGATRVLAAIDARMG
EVYWAEYQRDEQGVWHGEESEAVLKPEAVRERLQRLEGEWATVGTGWQAWPDLANGCGLT
LVDGDIQLPEAQDMLPLACYLLTAGKTVAVEHAEPVYLRNEVAWKKLPGRE