Protein Info for BWI76_RS17720 in Klebsiella michiganensis M5al

Annotation: muramoyltetrapeptide carboxypeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 PF02016: Peptidase_S66" amino acids 6 to 126 (121 residues), 80.7 bits, see alignment E=9.8e-27 PF17676: Peptidase_S66C" amino acids 170 to 283 (114 residues), 113.9 bits, see alignment E=7.3e-37

Best Hits

Swiss-Prot: 73% identical to LDCA_ECO57: Murein tetrapeptide carboxypeptidase (ldcA) from Escherichia coli O157:H7

KEGG orthology group: K01297, muramoyltetrapeptide carboxypeptidase [EC: 3.4.17.13] (inferred from 81% identity to kpn:KPN_02306)

MetaCyc: 73% identical to murein tetrapeptide carboxypeptidase (Escherichia coli K-12 substr. MG1655)
Muramoyltetrapeptide carboxypeptidase. [EC: 3.4.17.13]; RXN0-2061 [EC: 3.4.17.13]

Predicted SEED Role

"Muramoyltetrapeptide carboxypeptidase (EC 3.4.17.13)" (EC 3.4.17.13)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.17.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B5G9 at UniProt or InterPro

Protein Sequence (304 amino acids)

>BWI76_RS17720 muramoyltetrapeptide carboxypeptidase (Klebsiella michiganensis M5al)
MSQFYLIAPSGYCINQEAAYRGVQRLQEAGHQVAHQQVIPRRALRFAGTENERLGDINQL
AALDGKNRIVLAVRGGYGATRLLPHIDWQALIARQQQDPLLICGHSDFTAVQMGLLAKGS
IITFSGPMLAGNFGAETLNEFTEHHFWQALRDPAFTLEWHGEGPDCRADGTLWGGNLAML
TSLIGTPWMPQISDGILVVEDINEHPFRVERMLLQLLNSGILARQRAIILGSFTGANASD
YDAGYDLPMVYDYLRQQLNIPVISGLDFGHEQRTVTLPFGARALLVNNASITTLSISGHP
VLAE