Protein Info for BWI76_RS17695 in Klebsiella michiganensis M5al

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 transmembrane" amino acids 20 to 37 (18 residues), see Phobius details amino acids 43 to 62 (20 residues), see Phobius details amino acids 83 to 104 (22 residues), see Phobius details amino acids 110 to 134 (25 residues), see Phobius details amino acids 151 to 171 (21 residues), see Phobius details amino acids 183 to 203 (21 residues), see Phobius details amino acids 235 to 256 (22 residues), see Phobius details amino acids 268 to 286 (19 residues), see Phobius details amino acids 298 to 318 (21 residues), see Phobius details amino acids 325 to 346 (22 residues), see Phobius details amino acids 366 to 391 (26 residues), see Phobius details amino acids 405 to 427 (23 residues), see Phobius details TIGR00792: sugar (Glycoside-Pentoside-Hexuronide) transporter" amino acids 12 to 446 (435 residues), 382.1 bits, see alignment E=1.6e-118 PF13347: MFS_2" amino acids 14 to 434 (421 residues), 313.9 bits, see alignment E=1.4e-97 PF07690: MFS_1" amino acids 28 to 349 (322 residues), 44.9 bits, see alignment E=7.6e-16

Best Hits

Swiss-Prot: 38% identical to YAGG_ECOLI: Putative glycoside/cation symporter YagG (yagG) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 85% identity to enc:ECL_01522)

Predicted SEED Role

"Predicted beta-glucoside transporter, GPH family" in subsystem Beta-Glucoside Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B5L1 at UniProt or InterPro

Protein Sequence (452 amino acids)

>BWI76_RS17695 MFS transporter (Klebsiella michiganensis M5al)
MSAGDKISVREKVGYSLGDAASHIVFDSSVAILAYFYTDIYGLPPAVMGTMFLLVRLLDA
ITDPIMGAIADATSTRWGRFRPWLLAICVPFAVSCVLVYSIPSFSDSGKIVYAVAAYIFM
TLMYTAINIPYCSLGAALTSDPRESLSLQSWRFAITPIGGALGTAFILPLADFLYPGDRA
TGIQVSMALFGVIGCLMFVICFATTKERVQPIKEENLNIARDVKILFRNDQWRILSVYNF
MMLVAVVIRGGAVVYYVNNVLNKGSDVITIFMLGGMFASMLGSVLAKPFGTRFCKVRFSF
WINLLTAALGVVCFMLPVQYWIAVLGVHILISIIQGGNGALQWSMITDVNNYGEWKTQRR
ITGMNVAANIFVIKLGVAVGGAILGWVLAYYHYAANTAVQPASAVQGVVLLFTLVPSIFY
VLTAISIKFYGLTENRMNGIVDDLNHGTFAES