Protein Info for BWI76_RS17520 in Klebsiella michiganensis M5al

Annotation: carbamate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 310 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details PF00696: AA_kinase" amino acids 3 to 282 (280 residues), 87.5 bits, see alignment E=5.8e-29 TIGR00746: carbamate kinase" amino acids 3 to 309 (307 residues), 377.5 bits, see alignment E=2.2e-117

Best Hits

Swiss-Prot: 86% identical to ARCL_ECOLI: Carbamate kinase-like protein YqeA (yqeA) from Escherichia coli (strain K12)

KEGG orthology group: K00926, carbamate kinase [EC: 2.7.2.2] (inferred from 89% identity to cro:ROD_33991)

Predicted SEED Role

"Carbamate kinase (EC 2.7.2.2)" in subsystem Arginine Deiminase Pathway or Arginine and Ornithine Degradation or MLST or Polyamine Metabolism (EC 2.7.2.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.2.2

Use Curated BLAST to search for 2.7.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B5Q9 at UniProt or InterPro

Protein Sequence (310 amino acids)

>BWI76_RS17520 carbamate kinase (Klebsiella michiganensis M5al)
MSKKIVLALGGNALGDDLAGQMQAVRHTARTIVDLIALGHQVVVTHGNGPQVGMINQAFE
AAAKTEAHTPMLPMSVCVALSQGYIGYDLQNAIREELLSRQLDIPVATLITQVEVDANDE
AFLNPTKPIGSFFSKEEAEKLSQNGYIMKEDAGRGYRRVVASPKPVDIIEKQTVKALMDD
CHVVITVGGGGIPVIREGNHLRGASAVIDKDWASAKLAETIDADLLIILTAVEKVAINFG
KPGEQWLDNLSLRDAERFIAEGHFAKGSMLPKVEAAAAFARSRPGRQALITMLSKAKEGI
EGKTGTIISQ