Protein Info for BWI76_RS17340 in Klebsiella michiganensis M5al

Annotation: NarK family nitrate/nitrite MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 462 transmembrane" amino acids 38 to 62 (25 residues), see Phobius details amino acids 74 to 92 (19 residues), see Phobius details amino acids 104 to 123 (20 residues), see Phobius details amino acids 130 to 156 (27 residues), see Phobius details amino acids 176 to 197 (22 residues), see Phobius details amino acids 216 to 234 (19 residues), see Phobius details amino acids 255 to 278 (24 residues), see Phobius details amino acids 290 to 308 (19 residues), see Phobius details amino acids 320 to 340 (21 residues), see Phobius details amino acids 348 to 377 (30 residues), see Phobius details amino acids 404 to 424 (21 residues), see Phobius details amino acids 437 to 457 (21 residues), see Phobius details TIGR00886: nitrite transporter" amino acids 36 to 418 (383 residues), 371.9 bits, see alignment E=1.8e-115 PF07690: MFS_1" amino acids 46 to 421 (376 residues), 57 bits, see alignment E=8.3e-20

Best Hits

Swiss-Prot: 87% identical to NARK_ECOLI: Nitrate/nitrite transporter NarK (narK) from Escherichia coli (strain K12)

KEGG orthology group: K02575, MFS transporter, NNP family, nitrate/nitrite transporter (inferred from 95% identity to kpe:KPK_2092)

MetaCyc: 87% identical to nitrate:nitrite antiporter NarK (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-239

Predicted SEED Role

"Nitrate/nitrite transporter" in subsystem Nitrate and nitrite ammonification

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B592 at UniProt or InterPro

Protein Sequence (462 amino acids)

>BWI76_RS17340 NarK family nitrate/nitrite MFS transporter (Klebsiella michiganensis M5al)
MSHSSIPEKTTRSVISDWRPEDPEFWQQRGHRVASRNLWISVPCLLLAFCVWMLFSAVAV
NLNKVGFQFTTDQLFMLTALPALSGALLRVPYAFMVPLFGGRRWTAFSTGIMIVPCVWLG
FAVQDTATPFSVFVIISLLCGFAGANFASSMANISFFFPKQKQGGALGINGGLGNMGVSV
MQLVAPLVVSLSIFAVFGGTGSEQPDGSMLYLENAAWIWVPFLIIFTLAAWFFMNDLSAS
KASLSEQLPVLKRAHLWIMALLYLATFGSFIGFSAGFAMLSKTQFPDVQILHYAFFGPFI
GALARSTGGAISDRLGGTRVTLVNFVVMAIFCGLLFLTLPTHGEGGNFIAFFAVFMVLFL
TAGLGSASTFQMISVIFRKMTMDRVKAQGGSEAQAMREAATDTAAALGFISAIGAIGGFF
IPKAFGISLDLTGSPAGAMKVFLVFYIACVVITWAVYGRKQK