Protein Info for BWI76_RS16975 in Klebsiella michiganensis M5al
Annotation: cysteine desufuration protein SufE
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 92% identical to SUFE_KLEP7: Cysteine desulfuration protein SufE (sufE) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
KEGG orthology group: None (inferred from 91% identity to eae:EAE_17150)MetaCyc: 83% identical to sulfur carrier protein SufE (Escherichia coli K-12 substr. MG1655)
RXN0-7443
Predicted SEED Role
"Cysteine desulfurase (EC 2.8.1.7), SufS subfamily" in subsystem Alanine biosynthesis (EC 2.8.1.7)
MetaCyc Pathways
- superpathway of thiamine diphosphate biosynthesis I (10/10 steps found)
- thiazole component of thiamine diphosphate biosynthesis I (6/6 steps found)
- superpathway of L-alanine biosynthesis (4/4 steps found)
- superpathway of thiamine diphosphate biosynthesis II (9/11 steps found)
- molybdopterin biosynthesis (5/6 steps found)
- L-alanine biosynthesis III (1/1 steps found)
- L-cysteine degradation IV (1/1 steps found)
- thiazole component of thiamine diphosphate biosynthesis II (5/7 steps found)
- cytidylyl molybdenum cofactor sulfurylation (1/2 steps found)
- tRNA-uridine 2-thiolation and selenation (bacteria) (7/11 steps found)
- bis(guanylyl molybdopterin) cofactor sulfurylation (1/3 steps found)
- tRNA-uridine 2-thiolation (mammalian mitochondria) (1/4 steps found)
- tRNA-uridine 2-thiolation (yeast mitochondria) (1/4 steps found)
- tRNA-uridine 2-thiolation (thermophilic bacteria) (1/5 steps found)
- [2Fe-2S] iron-sulfur cluster biosynthesis (4/10 steps found)
- tRNA-uridine 2-thiolation (cytoplasmic) (1/8 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 2.8.1.7
Use Curated BLAST to search for 2.8.1.7
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A285B517 at UniProt or InterPro
Protein Sequence (138 amino acids)
>BWI76_RS16975 cysteine desufuration protein SufE (Klebsiella michiganensis M5al) MAALPDRDKLLRNFSRCANWEEKYLYIIELGQRLAPLSPEEHSAQNIIQGCQSQVWIVMA QELGGAIALRGDSDAAIVKGLIAVVFILYDQMTAKDITAFDVRPWFEKMALTQHLTPSRS QGLEAMIRAIRAKAANLS