Protein Info for BWI76_RS16915 in Klebsiella michiganensis M5al

Annotation: alpha/beta hydrolase fold protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF12146: Hydrolase_4
  • amino acids 35 to 267 (233 residues), 48.9 bits, E=8.3e-17
• PF00561: Abhydrolase_1
  • amino acids 37 to 274 (238 residues), 88.3 bits, E=1e-28
• PF12697: Abhydrolase_6
  • amino acids 38 to 278 (241 residues), 87.9 bits, E=2.4e-28

Best Hits

Swiss-Prot: 91% identical to MHPC_ECO7I: 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase (mhpC) from Escherichia coli O7:K1 (strain IAI39 / ExPEC)

KEGG orthology group: K05714, 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [EC: 3.7.1.-] (inferred from 91% identity to eco:b0349)

MetaCyc: 91% identical to 2-hydroxy-6-ketonona-2,4-dienedioate hydrolase (Escherichia coli K-12 substr. MG1655)
MHPCHYDROL-RXN [EC: 3.7.1.14]; 3.7.1.14 [EC: 3.7.1.14]

Predicted SEED Role

"2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase (EC 3.7.1.-)" in subsystem Cinnamic Acid Degradation (EC 3.7.1.-)

MetaCyc Pathways

• 3-phenylpropanoate and 3-(3-hydroxyphenyl)propanoate degradation (6/8 steps found)
• 3-phenylpropanoate and 3-(3-hydroxyphenyl)propanoate degradation to 2-hydroxypentadienoate (3/5 steps found)
• cinnamate and 3-hydroxycinnamate degradation to 2-hydroxypentadienoate (3/5 steps found)

KEGG Metabolic Maps

• 1,1,1-Trichloro-2,2-bis(4-chlorophenyl)ethane (DDT) degradation
• Ascorbate and aldarate metabolism
• Benzoate degradation via CoA ligation
• Benzoate degradation via hydroxylation
• Biphenyl degradation
• Caprolactam degradation
• Ethylbenzene degradation
• Inositol phosphate metabolism
• Limonene and pinene degradation
• Nicotinate and nicotinamide metabolism
• Phenylalanine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.7.1.-

Use Curated BLAST to search for 3.7.1.- or 3.7.1.14

Sequence Analysis Tools

See A0A285B4X6 at UniProt or InterPro

Protein Sequence (288 amino acids)

>BWI76_RS16915 alpha/beta hydrolase fold protein (Klebsiella michiganensis M5al)
MSYQPQTEAATSRFLNVEENGETLRIHFNDCGQGDETVVLLHGSGPGATGWANFSRNIDP
LVEAGYRVILLDCPGWGKSDSIVNSGSRSDLNARVLKSVVDQLDISKVHLLGNSMGGHSA
VAFTLTWPERVGKLVLMGGGTGGMSLFTPMPTEGIKLLNGLYREPTIENLKKMMNIFVFD
TRDLTDALFAARLNNMLSRREHLDNFVKSLEANPKQFPDFSPHLGEIRAQTLIVWGRNDR
FVPMDAGLRLLAGINGSELHIYRDCGHWAQWEHAESFNQLVLDFLARP