Protein Info for BWI76_RS16900 in Klebsiella michiganensis M5al
Annotation: 4-hydroxy-2-oxovalerate aldolase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 94% identical to HOA_KLEP3: 4-hydroxy-2-oxovalerate aldolase (mhpE) from Klebsiella pneumoniae (strain 342)
KEGG orthology group: K01666, 4-hydroxy 2-oxovalerate aldolase [EC: 4.1.3.39] (inferred from 94% identity to kpn:KPN_02117)MetaCyc: 91% identical to 4-hydroxy-2-oxovalerate aldolase (Escherichia coli K-12 substr. MG1655)
4-hydroxy-2-oxovalerate aldolase. [EC: 4.1.3.39]
Predicted SEED Role
"4-hydroxy-2-oxovalerate aldolase (EC 4.1.3.39)" (EC 4.1.3.39)
MetaCyc Pathways
- mandelate degradation to acetyl-CoA (14/18 steps found)
- 2-hydroxypenta-2,4-dienoate degradation (3/3 steps found)
- catechol degradation I (meta-cleavage pathway) (4/5 steps found)
- 3-phenylpropanoate and 3-(3-hydroxyphenyl)propanoate degradation (6/8 steps found)
- catechol degradation II (meta-cleavage pathway) (4/7 steps found)
- toluene degradation I (aerobic) (via o-cresol) (4/7 steps found)
- toluene degradation V (aerobic) (via toluene-cis-diol) (4/7 steps found)
- meta cleavage pathway of aromatic compounds (6/10 steps found)
- superpathway of aromatic compound degradation via 3-oxoadipate (23/35 steps found)
- toluene degradation IV (aerobic) (via catechol) (7/13 steps found)
- p-cumate degradation (3/8 steps found)
- naphthalene degradation to acetyl-CoA (5/12 steps found)
- L-tryptophan degradation IX (4/12 steps found)
- L-tryptophan degradation XII (Geobacillus) (4/12 steps found)
- p-cymene degradation (3/11 steps found)
- superpathway of aerobic toluene degradation (15/30 steps found)
- superpathway of aromatic compound degradation via 2-hydroxypentadienoate (17/42 steps found)
KEGG Metabolic Maps
- 1,4-Dichlorobenzene degradation
- Benzoate degradation via hydroxylation
- Biphenyl degradation
- Carbazole degradation
- Ethylbenzene degradation
- Fluorene degradation
- Phenylalanine metabolism
- Styrene degradation
- Toluene and xylene degradation
Isozymes
No predicted isozymesUse Curated BLAST to search for 4.1.3.39
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A285B4W7 at UniProt or InterPro
Protein Sequence (338 amino acids)
>BWI76_RS16900 4-hydroxy-2-oxovalerate aldolase (Klebsiella michiganensis M5al) MNGKKLYISDVTLRDGMHAIRHQYSLDNVRQIARALDSAGVDSIEVAHGDGLQGSSFNYG FGAHSDLEWIEAAAESVSQAKIATLLLPGIGTLHDLKNAYQAGARVVRVATHCTEADVSA QHIAFARELGMDTVGFLMMSHMTAPEQLAQQALKMESYGATCIYVVDSGGAMNMRDIRDR FRALKAVLKPETATGMHAHHNLSLGVANSIAAVEEGCDRIDASLAGMGAGAGNAPLEVFI AAADKLGWNHGTDLYALMNAADELVRPLQDRPVRVDRETLALGYAGVYSSFLRHSEAAAG RYGLSAVDILVELGKRRMVGGQEDMIVDVALDLLKRKK