Protein Info for BWI76_RS16865 in Klebsiella michiganensis M5al

Annotation: coenzyme F420-dependent N5,N10-methylene tetrahydromethanopterin reductase-related flavin-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 361 PF00296: Bac_luciferase" amino acids 12 to 323 (312 residues), 225 bits, see alignment E=7.6e-71

Best Hits

KEGG orthology group: None (inferred from 97% identity to eae:EAE_17240)

Predicted SEED Role

"Alkanesulfonate monooxygenase (EC 1.14.14.5)" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization (EC 1.14.14.5)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.14.14.5

Use Curated BLAST to search for 1.14.14.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B4W2 at UniProt or InterPro

Protein Sequence (361 amino acids)

>BWI76_RS16865 coenzyme F420-dependent N5,N10-methylene tetrahydromethanopterin reductase-related flavin-dependent oxidoreductase (Klebsiella michiganensis M5al)
MSIQFLGMIGHRLSSETIAPVGPIFDRDYIVRFAQTHEAAGFDRLLVGHWSDQPDGFLVT
ALAGLSTQHIGFLLAHRPGFVSPTLAARKFATLEHLLGGRLAVHIISGGNDAEQRRDGDY
LDHDQRYARTDAFLETVRKVWTAEQPVDIANDFYQAEQAWSAIRPLQKPHIPLYFGGSSE
AAIAVAGKHANVFALWGESLAQTAETIQRVRAEAAKHQREIGFSVSFRPIIAASEAEAWE
KAEHILHVATERAAQSGGGFKAKPDSVGAQRLRATAAQGKVVDKRLWTGIAQLVGGGHNS
TALVGTPEQVADALLDYYDLGVRNFLIRGFDPLNDAQEYGKALLPITREKAALRAVAERA
S