Protein Info for BWI76_RS16775 in Klebsiella michiganensis M5al
Annotation: malate/lactate/ureidoglycolate dehydrogenase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 72% identical to HCXB_ECO57: Hydroxycarboxylate dehydrogenase B (hcxB) from Escherichia coli O157:H7
KEGG orthology group: None (inferred from 85% identity to eae:EAE_17445)MetaCyc: 72% identical to hydroxycarboxylate dehydrogenase B (Escherichia coli K-12 substr. MG1655)
Hydroxyphenylpyruvate reductase. [EC: 1.1.1.237]
Predicted SEED Role
"Malate dehydrogenase (EC 1.1.1.37)" in subsystem Serine-glyoxylate cycle or TCA Cycle (EC 1.1.1.37)
MetaCyc Pathways
- superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (25/26 steps found)
- mixed acid fermentation (16/16 steps found)
- gluconeogenesis I (13/13 steps found)
- superpathway of glyoxylate bypass and TCA (11/12 steps found)
- superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
- TCA cycle I (prokaryotic) (9/10 steps found)
- glyoxylate cycle (6/6 steps found)
- superpathway of glyoxylate cycle and fatty acid degradation (11/14 steps found)
- TCA cycle III (animals) (8/10 steps found)
- TCA cycle VIII (Chlamydia) (5/6 steps found)
- (S)-lactate fermentation to propanoate, acetate and hydrogen (10/13 steps found)
- malate/L-aspartate shuttle pathway (2/2 steps found)
- TCA cycle II (plants and fungi) (7/9 steps found)
- TCA cycle IV (2-oxoglutarate decarboxylase) (7/9 steps found)
- TCA cycle V (2-oxoglutarate synthase) (7/9 steps found)
- gluconeogenesis III (9/12 steps found)
- C4 photosynthetic carbon assimilation cycle, NAD-ME type (8/11 steps found)
- reductive TCA cycle I (8/11 steps found)
- anaerobic energy metabolism (invertebrates, cytosol) (5/7 steps found)
- incomplete reductive TCA cycle (5/7 steps found)
- pyruvate fermentation to propanoate I (5/7 steps found)
- superpathway of anaerobic energy metabolism (invertebrates) (12/17 steps found)
- L-glutamate degradation VIII (to propanoate) (7/11 steps found)
- formaldehyde assimilation I (serine pathway) (8/13 steps found)
- reductive TCA cycle II (7/12 steps found)
- methylaspartate cycle (12/19 steps found)
- rosmarinic acid biosynthesis II (1/4 steps found)
- rosmarinic acid biosynthesis I (2/10 steps found)
- superpathway of rosmarinic acid biosynthesis (3/14 steps found)
- Methanobacterium thermoautotrophicum biosynthetic metabolism (23/56 steps found)
KEGG Metabolic Maps
- Alkaloid biosynthesis II
- Biosynthesis of alkaloids derived from histidine and purine
- Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of alkaloids derived from terpenoid and polyketide
- Biosynthesis of phenylpropanoids
- Biosynthesis of plant hormones
- Biosynthesis of terpenoids and steroids
- Carbon fixation in photosynthetic organisms
- Citrate cycle (TCA cycle)
- Glyoxylate and dicarboxylate metabolism
- Phenylalanine metabolism
- Pyruvate metabolism
- Reductive carboxylate cycle (CO2 fixation)
- Tyrosine metabolism
- Ubiquinone and menaquinone biosynthesis
Isozymes
Compare fitness of predicted isozymes for: 1.1.1.37
Use Curated BLAST to search for 1.1.1.237 or 1.1.1.37
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A285B4V0 at UniProt or InterPro
Protein Sequence (360 amino acids)
>BWI76_RS16775 malate/lactate/ureidoglycolate dehydrogenase (Klebsiella michiganensis M5al) MQTGHRFQATDLHQFVKTLFTHMGSSPTEASLIADHLIAANLAGHDSHGVGMIPSYVRSH AQGYLQLNRHASVMKDAGAVVTLDGNGGFGQVVAHEAMQIGIEKAKQHGLAAVALRNAHH IGRIGYWAEQCAAAGMISIHFVNVVGNVMVAPFRGKDSRFGTNPLCVVFPRVGHPPLLLD YATSAIAFGKTRVAWHKGVPVPAGSLIDARGVPTTDPAVMQTSPLGALLTFAEHKGYALA TLCEAIGGAVSGGKTSHQETLQGSVDAIFNCMTTIILSPEAFDAPDMQRETEAFIDWCKQ SPHEPDAPILAPGEWEEANRRQRLAQGIPLDAGSWQAICAAAEEVGVPADTLAQLRQKLA