Protein Info for BWI76_RS16690 in Klebsiella michiganensis M5al

Annotation: peptide ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 transmembrane" amino acids 40 to 61 (22 residues), see Phobius details amino acids 103 to 127 (25 residues), see Phobius details amino acids 140 to 159 (20 residues), see Phobius details amino acids 171 to 190 (20 residues), see Phobius details amino acids 221 to 242 (22 residues), see Phobius details amino acids 280 to 302 (23 residues), see Phobius details PF12911: OppC_N" amino acids 26 to 78 (53 residues), 57 bits, see alignment 1.5e-19 PF00528: BPD_transp_1" amino acids 119 to 311 (193 residues), 100.5 bits, see alignment E=9.6e-33

Best Hits

KEGG orthology group: None (inferred from 92% identity to eae:EAE_17580)

Predicted SEED Role

"Oligopeptide transport system permease protein OppC (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B509 at UniProt or InterPro

Protein Sequence (315 amino acids)

>BWI76_RS16690 peptide ABC transporter permease (Klebsiella michiganensis M5al)
MLSSLFSSNRRLRKAEIPALAQVTPSPWRQAWRALRRNRLAMLCLLLLTVMALWCVLGPL
WSPWQDDATDALMNNKPPGAAHWLGTDFLGRDIYTRLLLAGRISLIIGLLTMLLSVALGY
LLGALSGYAGGLTDKLIMRFADLVMTIPGLPLLIVAGAMLSELDFSPDSRIYMVVIMLSL
LEWPKLARLVRGQCLSLRERDFMLATQILGLSARRRLFGHLLPNTVPILVVMATMAVANA
ILSESALSYLGLGVVPPTPSWGNMMDAANSLIDFQRRPWLWMPPGIAIFITVIAINVLGD
GLRDAMDPKMKQRLK