Protein Info for BWI76_RS16645 in Klebsiella michiganensis M5al

Annotation: DeoR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 PF08280: HTH_Mga" amino acids 10 to 49 (40 residues), 24.1 bits, see alignment 6e-09 PF08220: HTH_DeoR" amino acids 11 to 63 (53 residues), 53.1 bits, see alignment E=4.3e-18 PF08279: HTH_11" amino acids 11 to 53 (43 residues), 34.6 bits, see alignment 2.9e-12 PF00455: DeoRC" amino acids 78 to 235 (158 residues), 139.8 bits, see alignment E=1.6e-44

Best Hits

KEGG orthology group: None (inferred from 90% identity to eae:EAE_17605)

Predicted SEED Role

"Transcriptional regulators of sugar metabolism"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B541 at UniProt or InterPro

Protein Sequence (256 amino acids)

>BWI76_RS16645 DeoR family transcriptional regulator (Klebsiella michiganensis M5al)
MLDYAAFPKQRQALICQILQENGRVVCAELADRLNVSEHTIRRDLHELSREGYCKKVYGG
AVMTLPEAGDYSERKEKNTATKSRIAQKCAKLVKPGGCIFIDTGTTNLAMAEALPAELAL
TVVTNSPEIAAVLLKKPLYDVVMLGGQIQRASGGCVGASAVAQIQGMLFDQGFIGGCAMA
PESGLTGFDYADCEFKKAVIKQCSEIIVGLTSDKIPAVARFVVVESSAIDVLVVEENISR
EYRDAFSEHDIRIYTV