Protein Info for BWI76_RS16510 in Klebsiella michiganensis M5al
Annotation: transcriptional repressor PurR
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 95% identical to PURR_KLEP3: HTH-type transcriptional repressor PurR (purR) from Klebsiella pneumoniae (strain 342)
KEGG orthology group: K03604, LacI family transcriptional regulator, purine nucleotide synthesis repressor (inferred from 95% identity to kpe:KPK_2351)MetaCyc: 92% identical to DNA-binding transcriptional repressor PurR (Escherichia coli K-12 substr. MG1655)
Predicted SEED Role
"Purine nucleotide synthesis repressor" in subsystem Purine nucleotide synthesis regulator
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A285B4Y2 at UniProt or InterPro
Protein Sequence (341 amino acids)
>BWI76_RS16510 transcriptional repressor PurR (Klebsiella michiganensis M5al) MATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTK SIGLLATSSEAAYFAEIIEAVEKSCFQKGYTLILGNAWNDPEKQRAYLSMMAQKRVDGLL VMCSEYPESVLSMLEEYRHIPMVVMDWGEAKADFTDSVVDNAFEGGYIAGRYLVERGHRD IGVIPGPLERNTGAGRLAGFMKAMEEAQINVPENWIVQGDFEPESGYRAMQQILAQHPRP TAIFCGGDIMAMGAICAADEMGLRVPQDISLIGYDNVRNARYFSPALTTIHQPKDSLGEA AFNMLLDRIVNKREVSQSIEVHPRLVERRSVADGPFVDYRR