Protein Info for BWI76_RS16510 in Klebsiella michiganensis M5al

Annotation: transcriptional repressor PurR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 PF00356: LacI" amino acids 3 to 48 (46 residues), 66.5 bits, see alignment 2.8e-22 PF00532: Peripla_BP_1" amino acids 59 to 323 (265 residues), 122.3 bits, see alignment E=5.8e-39 PF13407: Peripla_BP_4" amino acids 62 to 308 (247 residues), 80.1 bits, see alignment E=4.2e-26 PF13377: Peripla_BP_3" amino acids 171 to 331 (161 residues), 136.8 bits, see alignment E=1.5e-43

Best Hits

Swiss-Prot: 95% identical to PURR_KLEP3: HTH-type transcriptional repressor PurR (purR) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: K03604, LacI family transcriptional regulator, purine nucleotide synthesis repressor (inferred from 95% identity to kpe:KPK_2351)

MetaCyc: 92% identical to DNA-binding transcriptional repressor PurR (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Purine nucleotide synthesis repressor" in subsystem Purine nucleotide synthesis regulator

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B4Y2 at UniProt or InterPro

Protein Sequence (341 amino acids)

>BWI76_RS16510 transcriptional repressor PurR (Klebsiella michiganensis M5al)
MATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTK
SIGLLATSSEAAYFAEIIEAVEKSCFQKGYTLILGNAWNDPEKQRAYLSMMAQKRVDGLL
VMCSEYPESVLSMLEEYRHIPMVVMDWGEAKADFTDSVVDNAFEGGYIAGRYLVERGHRD
IGVIPGPLERNTGAGRLAGFMKAMEEAQINVPENWIVQGDFEPESGYRAMQQILAQHPRP
TAIFCGGDIMAMGAICAADEMGLRVPQDISLIGYDNVRNARYFSPALTTIHQPKDSLGEA
AFNMLLDRIVNKREVSQSIEVHPRLVERRSVADGPFVDYRR