Protein Info for BWI76_RS16445 in Klebsiella michiganensis M5al

Annotation: auxiliary transporter membrane fusion protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF00529: CusB_dom_1" amino acids 15 to 293 (279 residues), 28.3 bits, see alignment E=3.5e-10 TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 40 to 239 (200 residues), 119.5 bits, see alignment E=7.7e-39 PF13533: Biotin_lipoyl_2" amino acids 41 to 90 (50 residues), 54.5 bits, see alignment 1.9e-18 PF16576: HlyD_D23" amino acids 42 to 242 (201 residues), 48.7 bits, see alignment E=1.5e-16 PF13437: HlyD_3" amino acids 166 to 244 (79 residues), 41 bits, see alignment E=6.6e-14

Best Hits

Swiss-Prot: 64% identical to YDHJ_ECOLI: Uncharacterized protein YdhJ (ydhJ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 85% identity to eae:EAE_17855)

Predicted SEED Role

"Putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B4M9 at UniProt or InterPro

Protein Sequence (298 amino acids)

>BWI76_RS16445 auxiliary transporter membrane fusion protein (Klebsiella michiganensis M5al)
MKKLKYLSTLLVAALAIIAAWLVWNYYTQSPWTRDGKVRAEQVGVTPQVSGSILQLNVRD
NQLVKAGEVLFRIDDTPYKIALLNARAQLAKAKAEVARAQAEQKKAASDANRRRHLSQNF
ISAEDLENANTALNTATTNLEAAKAVVGVAQATLDHAQWQLTQTEIKAPVDGWVTNLSTR
VGDYAAVGHPVFALVDSHSFYVVGYFEETKLRHIRPGDSAQIILYSSKQKLQGHVGSIGR
AIVDQSVESSGGLVANIKPNIPWVRLAQRVPVRIEFDHLPPDTTLVSGTTCTVAIGAQ