Protein Info for BWI76_RS16375 in Klebsiella michiganensis M5al

Annotation: electron transport complex subunit G

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 206 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details TIGR01947: electron transport complex, RnfABCDGE type, G subunit" amino acids 9 to 192 (184 residues), 224.1 bits, see alignment E=8e-71 PF04205: FMN_bind" amino acids 99 to 187 (89 residues), 72.6 bits, see alignment E=1.6e-24

Best Hits

Swiss-Prot: 81% identical to RSXG_ECOLI: Ion-translocating oxidoreductase complex subunit G (rsxG) from Escherichia coli (strain K12)

KEGG orthology group: K03612, electron transport complex protein RnfG (inferred from 87% identity to kpe:KPK_2380)

Predicted SEED Role

"Electron transport complex protein RnfG" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B527 at UniProt or InterPro

Protein Sequence (206 amino acids)

>BWI76_RS16375 electron transport complex subunit G (Klebsiella michiganensis M5al)
MLQSMRKHGITLALFAAGSTGLTAAINELTKSTIEDQAAQQQKALFDQVMPAALYNNDLL
KSCYQVSAPELGKGQHKVWIAQDGEKPVAAVMEATAPDGYSGAIQLLVAADFKGTVLGTR
VTEHHETPGLGDKIELRISDWITLFAGKTIHGQDDSHWAVKKDGGDFDQFTGATITPRAV
VNAVKRAGLYAQTLPAQISAFTPCGD