Protein Info for BWI76_RS16325 in Klebsiella michiganensis M5al

Annotation: adenosine deaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 89% identical to ADD_KLEP3: Adenosine deaminase (add) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: None (inferred from 92% identity to eae:EAE_17980)

MetaCyc: 82% identical to adenosine deaminase (Escherichia coli K-12 substr. MG1655)
Adenosine deaminase. [EC: 3.5.4.4]; 3.5.4.4 [EC: 3.5.4.4]

Predicted SEED Role

"Adenosine deaminase (EC 3.5.4.4)" in subsystem Purine conversions (EC 3.5.4.4)

MetaCyc Pathways

purine nucleotides degradation II (aerobic) (11/11 steps found)
superpathway of purine deoxyribonucleosides degradation (7/7 steps found)
purine ribonucleosides degradation (6/6 steps found)
adenosine nucleotides degradation II (5/5 steps found)
adenine and adenosine salvage III (4/4 steps found)
purine deoxyribonucleosides degradation I (4/4 steps found)
adenine and adenosine salvage V (3/3 steps found)
purine deoxyribonucleosides degradation II (3/3 steps found)

KEGG Metabolic Maps

Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B516 at UniProt or InterPro

Protein Sequence (333 amino acids)

>BWI76_RS16325 adenosine deaminase (Klebsiella michiganensis M5al)
MIDLTLPLTDIHRHLDGNIRAQTILDLGRQFNLALPADTLDTLRPHVQVTSNEPNLVSFL
AKLDWGVKVLASLEACRRVAYENLEDAARNGLHYVELRFSPRYMAMTHQLPVAGVVEAVI
AGVKEGSRDFNVEARLIGILSRTFGEAACEEELEALLAHRDGITALDLAGDELGFPGNLF
MDHFRRARDAGWRITVHAGEAAGPESIWQAIRELGAERIGHGVKAVQDPALMDYLAAQRI
GIESCLTSNIQTSTVSSLAEHPLKTFLEHGVLACINTDDPAVQGVDIIHEYTFAAPAAGL
SREQIRQAQKNGLELAFLSAQEKAALIQRVQQA