Protein Info for BWI76_RS16235 in Klebsiella michiganensis M5al

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 111 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 28 to 47 (20 residues), see Phobius details amino acids 59 to 79 (21 residues), see Phobius details amino acids 85 to 107 (23 residues), see Phobius details PF06942: GlpM" amino acids 5 to 111 (107 residues), 178.8 bits, see alignment E=1.6e-57

Best Hits

Swiss-Prot: 79% identical to YDGC_ECOLI: Inner membrane protein YdgC (ydgC) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 96% identity to eae:EAE_18085)

Predicted SEED Role

"Putative inner membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B4R0 at UniProt or InterPro

Protein Sequence (111 amino acids)

>BWI76_RS16235 membrane protein (Klebsiella michiganensis M5al)
MGLLIKALLGALVVVLIGVLSKTKNYYIAGLIPLFPTFALIAHYIVASERGIEALRTTIV
FGMWSIIPYFIYLLSLWYFTGVMRLPFALAGAVVCWSLCAWLLIIGWSRFH