Protein Info for BWI76_RS16205 in Klebsiella michiganensis M5al

Annotation: NAD(P) transhydrogenase subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 509 transmembrane" amino acids 168 to 191 (24 residues), see Phobius details amino acids 400 to 417 (18 residues), see Phobius details amino acids 423 to 442 (20 residues), see Phobius details amino acids 452 to 471 (20 residues), see Phobius details amino acids 477 to 498 (22 residues), see Phobius details TIGR00561: NAD(P)(+) transhydrogenase (AB-specific), alpha subunit" amino acids 2 to 509 (508 residues), 995.2 bits, see alignment E=3e-304 PF05222: AlaDh_PNT_N" amino acids 4 to 137 (134 residues), 161.8 bits, see alignment E=1.6e-51 PF01262: AlaDh_PNT_C" amino acids 141 to 368 (228 residues), 243.8 bits, see alignment E=1.9e-76 PF12769: PNTB_4TM" amino acids 426 to 508 (83 residues), 120.6 bits, see alignment E=4.8e-39

Best Hits

Swiss-Prot: 90% identical to PNTA_ECOLI: NAD(P) transhydrogenase subunit alpha (pntA) from Escherichia coli (strain K12)

KEGG orthology group: K00324, NAD(P) transhydrogenase subunit alpha [EC: 1.6.1.2] (inferred from 96% identity to kva:Kvar_2832)

MetaCyc: 90% identical to pyridine nucleotide transhydrogenase subunit alpha (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-277 [EC: 7.1.1.1]

Predicted SEED Role

"NAD(P) transhydrogenase alpha subunit (EC 1.6.1.2)" in subsystem Phosphate metabolism (EC 1.6.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.1.2

Use Curated BLAST to search for 1.6.1.2 or 7.1.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B4H3 at UniProt or InterPro

Protein Sequence (509 amino acids)

>BWI76_RS16205 NAD(P) transhydrogenase subunit alpha (Klebsiella michiganensis M5al)
MRIGVPKERLAQETRAAATPKTVEQLLKLGFSVAVESGAGKLASFDDEAFVQAGAEIVSG
DDVWQSDVILKVNAPDDDEILLLNPGTTLISFIWPAQNPQLMEKLAARNINVMAMDSVPR
ISRAQSLDALSSMANIAGYRAIVEAAHEFGRFFTGQITAAGKVPPAKVMVIGAGVAGLAA
IGAANSLGAIVRAFDTRPEVKEQVQSMGAEFLELDFKEEAGSGDGYAKVMSEAFIKAEMA
LFAAQAKDVDIIVTTALIPGKPAPKLITREMVDSMKPGSVVVDLASQNGGNCEYTVPGQV
VTTANGVKIIGYTDLPGRLPTQSSQLYGTNLVNLLKLLCKEKDGNVVIDFDDVVIRGVTV
VREGEITWPAPPIQVSAQPQAAAKKVEAPKAEAKPSSPLRKYALMALAIILFGWLASVAP
KEFLGHFTVFALSCVVGYYVVWNVSHALHTPLMSVTNAISGIIVVGALLQIGHGGWVSFL
SFIAVLIASINIFGGFTVTQRMLKMFRKG