Protein Info for BWI76_RS16145 in Klebsiella michiganensis M5al
Annotation: 3-oxoadipate CoA-transferase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 71% identical to PCAI_PSEPU: 3-oxoadipate CoA-transferase subunit A (pcaI) from Pseudomonas putida
KEGG orthology group: K01031, 3-oxoadipate CoA-transferase, alpha subunit [EC: 2.8.3.6] (inferred from 95% identity to kpu:KP1_2555)MetaCyc: 71% identical to alpha subunit of beta-ketoadipate succinyl-CoA transferase (Pseudomonas putida)
3-oxoadipate CoA-transferase. [EC: 2.8.3.6]
Predicted SEED Role
"3-oxoadipate CoA-transferase subunit A (EC 2.8.3.6)" in subsystem Catechol branch of beta-ketoadipate pathway or Chloroaromatic degradation pathway or Protocatechuate branch of beta-ketoadipate pathway (EC 2.8.3.6)
MetaCyc Pathways
- aromatic compounds degradation via β-ketoadipate (9/9 steps found)
- superpathway of salicylate degradation (7/7 steps found)
- catechol degradation III (ortho-cleavage pathway) (6/6 steps found)
- mandelate degradation to acetyl-CoA (14/18 steps found)
- 3-oxoadipate degradation (2/2 steps found)
- 4-methylcatechol degradation (ortho cleavage) (5/7 steps found)
- toluene degradation III (aerobic) (via p-cresol) (7/11 steps found)
- superpathway of aromatic compound degradation via 3-oxoadipate (23/35 steps found)
- superpathway of aerobic toluene degradation (15/30 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 2.8.3.6
Use Curated BLAST to search for 2.8.3.6
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A285B4R9 at UniProt or InterPro
Protein Sequence (228 amino acids)
>BWI76_RS16145 3-oxoadipate CoA-transferase (Klebsiella michiganensis M5al) MIDKSVSTLRDAIAGIHDGATIMIGGFGPAGQPTYLIDALIEQGARDLTIINNNAGNGEV GLAALLKAGRVRKMICSFPRQVDSQIFDDLYRRGKVELELVPQGNLAARIQAAGAGLGAV FTPTGYGTPLAEGKETREIDGHHYVLEYPIKADFALIKAHQGDRWGNLVYRKAARNFGPI MATAAKTTIVEVSQLVPLGSLDPESIITPGIFVQRVFSLENLIAAKSA