Protein Info for BWI76_RS16110 in Klebsiella michiganensis M5al

Annotation: L-tartrate/succinate antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 501 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 47 to 64 (18 residues), see Phobius details amino acids 71 to 88 (18 residues), see Phobius details amino acids 108 to 131 (24 residues), see Phobius details amino acids 152 to 170 (19 residues), see Phobius details amino acids 207 to 236 (30 residues), see Phobius details amino acids 248 to 273 (26 residues), see Phobius details amino acids 302 to 319 (18 residues), see Phobius details amino acids 325 to 344 (20 residues), see Phobius details amino acids 356 to 378 (23 residues), see Phobius details amino acids 385 to 407 (23 residues), see Phobius details amino acids 412 to 430 (19 residues), see Phobius details amino acids 437 to 455 (19 residues), see Phobius details amino acids 475 to 496 (22 residues), see Phobius details PF00939: Na_sulph_symp" amino acids 22 to 500 (479 residues), 519.5 bits, see alignment E=1e-159 TIGR00785: transporter, divalent anion:Na+ symporter (DASS) family" amino acids 39 to 496 (458 residues), 495.2 bits, see alignment E=8.2e-153 PF03600: CitMHS" amino acids 60 to 428 (369 residues), 66.3 bits, see alignment E=2.8e-22

Best Hits

Swiss-Prot: 55% identical to TTDT_SHISS: L-tartrate/succinate antiporter (ttdT) from Shigella sonnei (strain Ss046)

KEGG orthology group: None (inferred from 97% identity to eae:EAE_18210)

MetaCyc: 55% identical to L-tartrate:succinate antiporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-127

Predicted SEED Role

"2-oxoglutarate/malate translocator" in subsystem Photorespiration (oxidative C2 cycle)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B4F6 at UniProt or InterPro

Protein Sequence (501 amino acids)

>BWI76_RS16110 L-tartrate/succinate antiporter (Klebsiella michiganensis M5al)
MKEKQTTIPPAGAAKNAAYKRLLMMAMPIIVAVLLLFVPVPEGLPPYAWHYFAIFVGVIV
GLIFEPLPGAVIGITGVVVIALCSQWLLFSPEQLAAPNFKLAGASFKWAVSGFGNSTVWL
IFGAFMFAAGYDKTQFGRRLALILVKYLGRRSLTLGYAITFADLLLAPFTPSNTARSGGT
IYPIIANLPPLYGSKPNDPSARRIGSYLMWVAITAACITSSMFLSALAPNLLALALVKSI
VGINISWGTWFIAFLPLGILLILTMPLLAYWFYPPEVKVNDEVPLWAARELEKLGRLSRN
EILLLVFVCFALMMWIFAAEWIEPALAALLVIVLMLWTGVLSWNDITSNKAAWNTFAWFA
TLVALADGLSSTGFIAWLGKEGGALMSGISPGVATVVLLLAFYLLHYLFASTTAHTTALL
PAMLTIASTIPGMNMQVFVLLMVTSLGVMGIITPYGTGPSPIYYGSGYLPTKDYWRLGTI
FGAIFLAALLLIGYPWMSMMF