Protein Info for BWI76_RS16095 in Klebsiella michiganensis M5al

Annotation: thiamine biosynthesis protein ApbE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details PF02424: ApbE" amino acids 14 to 285 (272 residues), 266.4 bits, see alignment E=1.6e-83

Best Hits

Swiss-Prot: 82% identical to APBE2_KLEP3: FAD:protein FMN transferase (apbE2) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: None (inferred from 87% identity to eae:EAE_18225)

Predicted SEED Role

"Hypothetical similar to thiamin biosynthesis lipoprotein ApbE" in subsystem Sex pheromones in Enterococcus faecalis and other Firmicutes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B4Q9 at UniProt or InterPro

Protein Sequence (316 amino acids)

>BWI76_RS16095 thiamine biosynthesis protein ApbE (Klebsiella michiganensis M5al)
MSDNRVYSYSAVLMGSPILLKLYVHDEPLASRVFQLIKGYEDLFTVNRAQSQVMDINHAA
GRHPVTVSRPVYALIKCAKAASMVRDSAFNLAIGPLVKLWRIGFQGQSVPAAQDIAARLT
LTRPQDIILDDAAGSVYLARAGMEIDLGAIAKGYIADRVRDYLRQQGVSAALINLGGNVH
TLGEWSIGLKKPYSAADALIGSIAVAGQSVVTSGIYERYFEQDGKRWHHILDPRSGYPLD
NELESVTIISADSLDGDIWTTLIYGLGVEKGCAALRQREDIEAIFVTKNRDVILSSQRHF
RFQLLDDGYRLTGCTA