Protein Info for BWI76_RS15340 in Klebsiella michiganensis M5al

Annotation: urea ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 423 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF13458: Peripla_BP_6" amino acids 30 to 387 (358 residues), 259.3 bits, see alignment E=8.1e-81 TIGR03407: urea ABC transporter, urea binding protein" amino acids 31 to 404 (374 residues), 591.5 bits, see alignment E=2.7e-182 PF13433: Peripla_BP_5" amino acids 31 to 405 (375 residues), 545.9 bits, see alignment E=4.8e-168

Best Hits

KEGG orthology group: K01999, branched-chain amino acid transport system substrate-binding protein (inferred from 96% identity to kpe:KPK_2768)

Predicted SEED Role

"Urea ABC transporter, urea binding protein" in subsystem Urea decomposition

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B4H4 at UniProt or InterPro

Protein Sequence (423 amino acids)

>BWI76_RS15340 urea ABC transporter substrate-binding protein (Klebsiella michiganensis M5al)
MQRRTLLKAFALSASVISMGFSLQVYAADTIKVGIMHSLSGTMAISETPLKDVALMAIDD
INAKGGVLGKKLEPVVVDPASNWPLFAEKARQLLTQDKVAAVFGCWTSVSRKSVLPVFEE
LNGLLFYPVQYEGEEMSPNVFYTGAAPNQQAIPAVEYLLSEDGGGAKRFFLLGTDYVYPR
TTNKILRAFLHAKGIQDKDIEEVYTPFGYSDYQTIVANIKKFSAGGKTAVVSTINGDSNV
PFYKELANQGLKATDVPVVAFSVGEEELRGIDTKPLVGNLAAWNYFESVDNPTNKQFVAD
YRAYAKAHKLPNADTVVTNDPMEATWVGLHMWAQAVTKAGTTDVDKVREAMAGQTFKAPS
GFTLTMDATNHHLHKPVMIGEIESNGQFNVVWQTEEPVRAQPWSPWIAGNDKKPDHPVKT
ASN