Protein Info for BWI76_RS15295 in Klebsiella michiganensis M5al

Annotation: MDR efflux pump AcrAB transcriptional activator MarA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 126 PF00165: HTH_AraC" amino acids 18 to 59 (42 residues), 27.4 bits, see alignment E=2.8e-10 amino acids 70 to 108 (39 residues), 30.9 bits, see alignment E=2.3e-11 PF12833: HTH_18" amino acids 32 to 108 (77 residues), 69.6 bits, see alignment E=2.4e-23

Best Hits

Swiss-Prot: 93% identical to MARA_SALEN: Multiple antibiotic resistance protein MarA (marA) from Salmonella enteritidis

KEGG orthology group: K13632, AraC family transcriptional regulator, multiple antibiotic resistance protein MarA (inferred from 94% identity to esc:Entcl_2297)

Predicted SEED Role

"Multiple antibiotic resistance protein MarA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B4G2 at UniProt or InterPro

Protein Sequence (126 amino acids)

>BWI76_RS15295 MDR efflux pump AcrAB transcriptional activator MarA (Klebsiella michiganensis M5al)
MSRRNNDAITIHSILSWIEDNLESPLSLEKVSERSGYSKWHLQRMFKKETGHSLGQYIRS
RKLTEIAQKLKQSNEPILYLAERYGFESQQTLTRTFKNYFDVPPHQYRITNVPGESRYLL
PLNNCC